KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11155Help
Entry
RCFBP_11155       CDS       T01272                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RCFBP_11155 (galU)
   00052 Galactose metabolism
    RCFBP_11155 (galU)
   00500 Starch and sucrose metabolism
    RCFBP_11155 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    RCFBP_11155 (galU)
Enzymes [BR:rsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RCFBP_11155 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1191736..1192608)
Genome map
AA seq 290 aa AA seqDB search
MQRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRS
KRAIEDHFDKAYELEAELEAKQKTALLEVVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVGNAPFAVILADDLLDGNPPVMKQMVDLYDHYNCSVIGVEEIEREQSRSYGVVDGRPWE
EDGSVIKMSGIVEKPAPENAPSNLGVVGRYILTPRIFDHIRNIKPGAGGELQLTDAIQSL
LSAEQVLAYRYKGVRYDCGSKLGYLKATVELALKHKEVAEEFREYLASRG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgtcaccaaagccgtcttccccgttgcgggactgggaacccgcttcctgccc
gccaccaaggccagcccgaaggaaatgctgccggtggtcgacaaacccctgatccagtac
gccgtggaagaagccatggccgccggcatcaccgagatgatcttcgtgaccggccgcagc
aagcgcgccatcgaagaccacttcgacaaggcctacgaactggaagccgaactggaagcc
aagcagaagacggcgctgctcgaagtggtgcgctcgatcaagccgtcgcacgtggactgc
ttctacgtgcgccagccggaagcgctgggcctgggccacgcggtgctgtgcgccgaaaag
ctggtcggcaacgcgcccttcgcggtcatcctggccgacgacctgctcgacggcaatccg
ccggtgatgaagcagatggtcgatctgtatgaccactacaactgctcggtgatcggcgtg
gaagagatcgagcgcgagcagagccgctcgtacggcgtggtcgacggccgcccgtgggag
gaggacggcagcgtgatcaagatgtcgggcatcgtcgagaagccggccccggaaaatgcc
ccgtccaacctgggcgtggtcggccgctacatcctcacgccgcgcatcttcgaccacatc
cgcaacatcaagccgggcgcgggcggcgagctgcagctcacggacgcgatccagtcgctg
ctgtcggccgagcaggtgctggcctaccgctacaagggcgtgcgctacgactgcggcagc
aagctgggctacctgaaggccacggtcgaactggcgctcaagcacaaagaagtggccgag
gagttccgcgagtacctggcctcgcgcggctga

DBGET integrated database retrieval system