KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11324Help
Entry
RCFBP_11324       CDS       T01272                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCFBP_11324 (tpiA)
   01230 Biosynthesis of amino acids
    RCFBP_11324 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCFBP_11324 (tpiA)
   00051 Fructose and mannose metabolism
    RCFBP_11324 (tpiA)
   00562 Inositol phosphate metabolism
    RCFBP_11324 (tpiA)
Enzymes [BR:rsc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RCFBP_11324 (tpiA)
Exosome [BR:rsc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RCFBP_11324 (tpiA)
  Exosomal proteins of bladder cancer cells
   RCFBP_11324 (tpiA)
  Exosomal proteins of melanoma cells
   RCFBP_11324 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1360039..1360785
Genome map
AA seq 248 aa AA seqDB search
MSARPKLVVGNWKLHGSLNGNAELLEKIKEAGQTRAALAVCVPFPYLAQCQSLLAGSAVA
WGAQDVSAEARGAFTGEVAASMLSEFGCGYAIVGHSERRTYHGEADAQVAAKALRALEHG
ITPIVCVGETLAQREAGETEQVVARQLGAVLEALSVEQLGRIVVAYEPVWAIGTGKTATS
EQAQAVHAFLRGRVATCDAGVAQRMPILYGGSVKPDNAAELFAMADIDGGLIGGASLKAE
DFLAIGRA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaagaccgaagctggtggtgggcaactggaagttgcatggcagcctgaacggc
aacgccgagctccttgagaagatcaaggaggccggccagacccgcgctgcgctggcagtc
tgcgtgccgttcccctacctggcccagtgccagtcgctgctcgccggctcggccgtggcc
tggggcgcgcaggatgtgtcggccgaggcgcgcggcgccttcaccggcgaggtggcggcg
tcgatgctgtccgaattcggttgcggctacgcgatcgtgggacactccgagcgccgcacg
tatcacggcgaggccgacgcgcaagtggcggccaaggcgctgcgcgcgctggagcacggc
atcaccccgatcgtctgtgtcggcgaaacgctggcacagcgcgaagccggggagaccgag
caagtcgtggcccgtcaactgggcgcggtgctggaggcgctgtcggtggagcaactgggc
cgcatcgtcgtggcctatgagccggtctgggccatcggcacaggcaagaccgcgaccagc
gagcaggcgcaggcggtgcatgcgttcctgcgcggccgcgtggccacctgcgacgccggt
gttgcgcagcgcatgccgatcctgtacggcggcagcgtcaagcccgacaatgcggccgag
ctgtttgcgatggcggacatcgatggcggcctgatcggcggcgcatccctgaaggccgaa
gatttcctggcgatcggccgggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system