KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11390Help
Entry
RCFBP_11390       CDS       T01272                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhc (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCFBP_11390 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RCFBP_11390 (sdhD)
   00650 Butanoate metabolism
    RCFBP_11390 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RCFBP_11390 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1425673..1426038
Genome map
AA seq 121 aa AA seqDB search
MAQNNIGPKRLVVGAHYGLKDFLAQRVTAVVMAVYTIVLLAAFLFSKDTSYQSWAGLFAN
QWMKLLTFLAFLSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaacaatatcggtcccaagcgcctcgtcgtcggcgcacactacggcctgaag
gacttcctcgcgcagcgcgtcaccgccgtggtcatggcggtctacaccatcgtgctgctg
gccgcgttcctgttctcgaaagacacgtcgtatcaaagctgggcaggcctgttcgccaac
cagtggatgaaactactgacgttcctcgccttcctgtcgctcacgtatcacgcctggatc
ggcgtgcgtgacatctggatggactacgtgaagcccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgtgcgggctacgcagctcagattctctggagg
gtttaa

DBGET integrated database retrieval system