KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11396Help
Entry
RCFBP_11396       CDS       T01272                                 

Gene name
leuD
Definition
(GenBank) 3-isopropylmalate isomerase, subunit with LeuC
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00290  Valine, leucine and isoleucine biosynthesis
rsc00660  C5-Branched dibasic acid metabolism
rsc01100  Metabolic pathways
rsc01110  Biosynthesis of secondary metabolites
rsc01210  2-Oxocarboxylic acid metabolism
rsc01230  Biosynthesis of amino acids
Module
rsc_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    RCFBP_11396 (leuD)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    RCFBP_11396 (leuD)
Enzymes [BR:rsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     RCFBP_11396 (leuD)
    4.2.1.35  (R)-2-methylmalate dehydratase
     RCFBP_11396 (leuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C
Motif
Other DBs
NCBI-ProteinID: CBJ42693
UniProt: D8NSH4
Position
1431935..1432585
Genome map
AA seq 216 aa AA seqDB search
MEQFTIHTGLVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNLFDEWRYLDVGQPGQDNSN
RPLNPDFVLNQPRYQGASILLARKNFGCGSSREHAPWALQQYGFRAIIAPSFADIFFNNC
FKNGLLPIALTESQVDHLFNETAAFNGYQLTVDLDKQVVVTPGGTAYPFDVTAFRKYCLL
NGFDDIGLTLRYADKIKVFEAQRLAKMPWLGHKLVG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggaacaattcactatccacaccggcctggttgcgccgctggaccgcgagaacgtcgat
accgacgccatcatcccgaagcaattcctcaagtcgatcaagcgcaccggcttcggcccg
aacctgttcgacgaatggcgctacctggatgtcggccagccggggcaggacaacagcaac
cgtccgctcaacccggacttcgtgctgaaccagccgcgctaccagggcgcctccatcctg
ctggcgcgcaagaacttcggctgcggcagctcgcgtgagcatgcgccctgggcgctgcag
cagtacggctttcgcgccatcatcgcgccgagcttcgccgacatcttcttcaacaactgc
ttcaagaacggcctgctgccgatcgcgctgacggagtcgcaggtcgaccacctgttcaac
gagacggccgccttcaatggctaccaactgacggtggacctggacaagcaggtcgtcgtc
acgcccggtggcacggcctatccgttcgacgtcacggcattccgcaagtactgcctgctc
aacggcttcgacgatatcggcctgaccctgcgctacgccgacaagatcaaggtcttcgag
gcgcagcgcctggcgaagatgccgtggctgggccacaagctggtcggctga

DBGET integrated database retrieval system