KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11403Help
Entry
RCFBP_11403       CDS       T01272                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00260  Glycine, serine and threonine metabolism
rsc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsc01100  Metabolic pathways
rsc01110  Biosynthesis of secondary metabolites
rsc01130  Biosynthesis of antibiotics
rsc01230  Biosynthesis of amino acids
Module
rsc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCFBP_11403 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCFBP_11403 (trpB)
Enzymes [BR:rsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCFBP_11403 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBJ42700
UniProt: D8NSI1
Position
1440114..1441307
Genome map
AA seq 397 aa AA seqDB search
MYNLPDAHGHFGPYGGTFVAETLSHALDELRDAYARYQHDPEFIKEYEYELKHFVGRPSP
IYHARRLTEHCGGAQIYLKREDLNHTGAHKVNNVIGQALLARRMGKPRVIAETGAGQHGV
ATATIAARYGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVADTFYIIGTVAGPHPYPMMVRDFQSVIGEECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDHADVKLIGVEAAGEGIESGRHAASLTGGSPGVLHGNRTYLLQDEDGQIIET
HSISAGLDYPGVGPEHAWLKDAGRAQYVGITDKEALQAFHDLCRMEGIIPALESSHALAY
ACKLAPTLPKDQVLLINLSGRGDKDMHTVAELSGIEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacctgcccgacgcccacggtcacttcggaccctacggcggtacctttgtcgcg
gaaaccctgtcccacgcgctggacgaactgcgcgatgcctacgcgcgttaccagcacgat
cccgagttcatcaaggaatacgagtacgagctgaagcatttcgtcggccgtccgtcgccc
atctaccatgcccgccgcctgaccgagcactgcggcggcgcgcagatctacctcaagcgc
gaagacctgaaccacaccggcgcccacaaggtgaacaacgtcatcggccaggcgctgctg
gcgcgccgcatgggcaagccgcgcgtgatcgccgagaccggcgccggccagcacggcgtg
gcgacggccaccatcgccgcgcgctacggcatggaatgcgtggtctacatgggcagcgag
gatgtgcgccgccaggccgccaacgtctatcgcatgaagctgctgggcgcgaccgtggtg
ccggtggagtccggctcgcgcacgctcaaggacgcgctcaacgaagccatgcgcgactgg
gtcaccaatgtggccgacaccttctacatcatcggcacggtggcgggcccgcatccgtat
ccgatgatggtgcgcgacttccagtcggtgatcggcgaggagtgcaaggtgcagatgccc
gagctggccggccgccagccggatgcggtgatcgcctgcgtgggcggcggctccaatgcc
atgggcatcttctatccgtacatcgaccacgccgatgtcaagctgatcggcgtggaggcg
gcgggcgagggcatcgagtcgggccgtcatgccgcatcgctcacgggcggctcgccgggc
gtgctgcacggcaaccgaacctatctgctgcaggacgaggacggccagatcatcgagacg
cattcgatctcggcgggcctggattatccgggcgtcggtcccgagcatgcctggctgaag
gacgccggccgcgcgcagtatgtcggcatcaccgacaaggaagcgctgcaggccttccac
gacctgtgccgcatggagggcatcattcccgcgctggagtcgagccacgcgctggcctat
gcctgcaagctggcgccgacgctgcccaaggaccaggtcctgctgatcaacctgtccggc
cgcggcgacaaggacatgcataccgtcgccgaactctcgggcatcgagctctga

DBGET integrated database retrieval system