KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11405Help
Entry
RCFBP_11405       CDS       T01272                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCFBP_11405 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCFBP_11405 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCFBP_11405 (trpA)
Enzymes [BR:rsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCFBP_11405 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1442149..1442946
Genome map
AA seq 265 aa AA seqDB search
MSRIAQTFSQLSAQGRKGLIPFITAGDPYPELTVDLMHALVKGGANVIELGVPFSDPMAD
GPVIQRASERALAKKIGLRTVLDYVRAFRTTDKTTPVVLMGYANPIERMGIDAFAKAASE
AGVDGVLVVDYPPEECEAFAKTMRATGIDPIFLLAPTSTEARIAQIARVASGYLYYVSLK
GVTGAATLDLDSVAARIPQIRQHARLPVGVGFGIRDAATARAISGVADAVVIGSRIVQLL
EEAPREQAVQCLTDFIADIRRALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcatcgctcaaactttttcgcaactgtccgcgcagggccgcaagggcctgatt
ccgttcatcacggcgggtgatccgtaccccgaactgaccgttgacctgatgcacgcgctg
gtcaagggcggcgccaatgtcatcgaactgggcgtgccgttttccgacccgatggccgat
ggcccggtcatccagcgtgcgtcggagcgcgcactcgccaagaaaatcggtctgcgcacc
gtgctggattacgtacgtgcgttccgcaccaccgacaagacgacgcccgtggtgctgatg
ggctacgccaacccgatcgagcgcatgggcatcgacgccttcgccaaggccgcatcggaa
gccggcgtggatggcgtgctggtggtggactatccgcccgaggaatgcgaggcgttcgcc
aagaccatgcgggctacgggcatcgacccgatcttcctgctggcgcccacctcgaccgaa
gcgcgcatcgcgcagatcgcccgggtggcgagcggctacctctactacgtgtcgctcaag
ggggtgacgggcgcggcgacgctggacctcgacagcgtggcggcacgcatcccgcagatt
cgccagcacgcgcggctgccggtgggggtcggcttcggcatccgcgatgcggcgacggca
cgtgcgatcagtggtgtggccgatgcggtggtgatcggatcccgcattgtgcaattgctg
gaggaggccccccgcgaacaagcggtacaatgtctgactgatttcatcgcggacatccgc
cgggcgctcgacgcctga

DBGET integrated database retrieval system