KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11432Help
Entry
RCFBP_11432       CDS       T01272                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00010  Glycolysis / Gluconeogenesis
rsc00620  Pyruvate metabolism
rsc00640  Propanoate metabolism
rsc00680  Methane metabolism
rsc01100  Metabolic pathways
rsc01110  Biosynthesis of secondary metabolites
rsc01120  Microbial metabolism in diverse environments
rsc01130  Biosynthesis of antibiotics
rsc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCFBP_11432 (acsA)
   00620 Pyruvate metabolism
    RCFBP_11432 (acsA)
   00640 Propanoate metabolism
    RCFBP_11432 (acsA)
  Energy metabolism
   00680 Methane metabolism
    RCFBP_11432 (acsA)
Enzymes [BR:rsc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RCFBP_11432 (acsA)
Lipid biosynthesis proteins [BR:rsc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RCFBP_11432 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBJ42729
UniProt: D8NI57
Position
1466246..1468228
Genome map
AA seq 660 aa AA seqDB search
MTGIESVLQETRVFEPPASFVKQANIAGMDAYRALCAEAERDYEGFWARLAHEHLLWHKP
FSKVLDESKAPFYTWFEDGELNASYNCLERNLENGNADKVAVIFEADDGTVARVTYRELH
ARVCRFANGLKALGIRKGDRVVIYMPMSVEGVVAMQACARIGATHSVVFGGFSAKSLQER
IVDVGAIAVITADEQMRGGKALPLKAIADEALAMEGTEAVRHVVVYRRTGAGVNWVDGRD
RAMDEVEAGQPDTCEVTPVSAEHPLFILYTSGSTGKPKGVQHSTGGYLLWALLTMQWTFD
LKHDDIFWCTADIGWVTGHTYIAYGPLAAGATQVVFEGVPTYPNAGRFWDMIQRHKVNTF
YTAPTAIRSLIKAAEADEKSHPKQYDLSSLRLLGTVGEPINPEAWMWYHTNIGGGRCPIV
DTFWQTETGGHMISPLPGVTPLVPGSCTLPLPGILAAIVDETGQDVPNGQGGILVVKRPW
PSMIRTIWGDPERFRKSYFPAELGGKLYLAGDGAVRDKETGYFTIMGRIDDVLNVSGHRM
GTMEIESALVANPLVAEAAVVGRPDDMTGEAICAFVVLKRTRPNGDEARQIATDLRNWVG
KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSIAKGEDITQDTSTLENPAILEQLKEAR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgactggtattgaatctgttctgcaggaaacgcgtgtcttcgagccgcccgcgtccttc
gtcaagcaggccaacatcgccggcatggacgcttaccgcgccttgtgcgccgaggccgag
cgcgactacgagggcttctgggcgcgcctggcgcacgagcacctgctgtggcacaagcct
ttctccaaggtcctcgacgaatccaaggcgccgttctacacgtggttcgaggacggcgag
ctcaacgcctcgtacaactgcctcgagcgcaacctggagaacggcaacgccgacaaggtc
gccgtgatcttcgaggccgacgatggcacggtcgcgcgcgtcacctatcgcgaactgcat
gcccgcgtgtgccgcttcgccaatggcctgaaagcgcttggcatccgcaagggcgaccgg
gtggtgatctatatgccgatgtcggtcgaaggcgttgtcgccatgcaggcctgcgcgcgc
atcggcgcgacgcactcggtggtgttcggcgggttctcggccaagtcgctgcaggagcgg
atcgtcgacgtgggggccatcgctgtcatcaccgccgacgagcagatgcgcggcggcaag
gcactgccgctcaaggccatcgccgacgaagccctggcgatggagggcaccgaggccgtc
cggcatgtggtcgtctaccggcgcaccggcgccggcgtgaactgggtcgatggccgcgac
cgcgccatggacgaggtcgaagccggccagcccgatacctgcgaggtgacgccggtcagt
gccgagcacccgctgttcatcctctacacctcgggctcgaccggcaagcccaagggcgtg
cagcacagcaccggcggctacctgctgtgggcgctgctgacgatgcagtggaccttcgac
ctgaagcacgacgacatcttctggtgcactgccgacatcggctgggtcaccggccacacg
tatattgcctatggtccgctcgccgccggcgccacccaggtggtgttcgagggcgtgccg
acttacccgaacgccggccgcttctgggacatgatccagcggcacaaggtcaacaccttc
tacaccgcgccgacggcgatccgctcgctgatcaaggccgccgaggccgacgagaagagc
cacccgaagcagtacgacctgtccagcctgcgcctgctgggcaccgtgggcgagccgatc
aacccggaagcctggatgtggtaccacacgaatattggcggcggccgttgcccgatcgtc
gataccttctggcagaccgagactggcggccacatgatctcgccgctgccgggcgtgaca
ccgctggtgccgggctcgtgcacgctgccgctgccgggcatcctggccgccatcgtcgac
gagaccgggcaggacgtgccgaacgggcagggcggcatccttgtcgtcaagcggccgtgg
ccgtcgatgatccgcaccatctggggcgatccggagcgcttccgcaagagctacttcccg
gccgagctgggcggcaagctttacctggccggcgacggcgcggtgcgcgacaaggagacc
ggctacttcaccatcatgggccgcatcgatgacgtgctgaacgtctcgggccaccgcatg
ggcacgatggagatcgagtcggcgctggtggccaatccgctggtggccgaggccgccgtg
gtgggccgccccgacgacatgaccggcgaggccatctgcgccttcgtggtgctcaagcgc
acgcgcccgaacggggacgaagcccggcagatcgccaccgacctgcgcaactgggtcggc
aaggagatcggcccgatcgccaagcccaaggacatccgcttcggcgataacctgcccaag
acgcgctcgggcaagatcatgcggcgcctgttgcgctcgatcgccaagggcgaggacatc
acgcaggacacgtccacgctggagaacccggccatcctggagcagctcaaggaagcccgc
tga

DBGET integrated database retrieval system