KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11480Help
Entry
RCFBP_11480       CDS       T01272                                 

Definition
polyphenol oxidase oxidoreductase protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    RCFBP_11480
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RCFBP_11480
Enzymes [BR:rsc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     RCFBP_11480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1516244..1517482
Genome map
AA seq 412 aa AA seqDB search
MRIDFTINNGSDASARYLTWALSPLRLRLLDATPGPDVAVTLSEDRQPNGGSVRFCATQG
GNYTPTLKVSMPTNGASVMVYVRGRFGAPSQVDGDVSIVVSGPTSELGRLPVMVRVRKNA
NQLTAAERDRFISAMAQLNNRGTGRFTDFRNMHVAGLADKQAHDGPGFLPWHRAYLLDLE
RELQAIDPAVTIPYWRFDRPAPNLFTTDFIGVPDALGTVGFSPANPLQFWATDGVQGILR
RQLGVSPGDQANPNIRTETQTLALGGSYQNFRTMQTNPHGSAHVNYFGGSISSIPTAAKD
PLFFLLHCNVDRLWAKWQSQVGRYDANVAAAYESKPNPPNWLAGHNLNDTLWPWNGIVTP
PRPSTAPGGPMADSSCVPAPGRHPQVSDMLDFQGVVNSSAKLGFAYDDVPSP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgacttcacgatcaacaacggtagcgatgcatcagcccgctacctcacctgg
gcgctgtcgccattgcggctccggcttctcgatgccacgccgggtccggatgtggccgtg
acgctttcggaagatcgccagcccaacggtggctcagtccggttctgtgcgacacagggt
ggcaactacacgccgacactcaaagtctcgatgccgacaaacggcgcctccgtgatggtc
tacgtccggggacgattcggcgcacccagtcaggtcgacggcgatgtgagtatcgtggtc
agcgggccgacgtcggaacttggccgactgcccgtcatggtgcgggtgcgcaagaatgcg
aaccagttgactgcggccgagcgggatcgcttcatctcggccatggctcagctcaataac
cgggggacgggacggttcaccgatttccgcaacatgcatgtcgcgggcctagccgataag
caggcccatgacggtcccggctttctaccctggcatcgggcttacttgctggatctggag
cgcgagttgcaggccattgatcccgcggtgacgattccgtactggcgttttgatcggccc
gcgccgaatttgtttaccacggacttcatcggtgtgccggacgctctcggcacggtgggt
ttcagtccggccaacccgctgcagttctgggccaccgatggcgtgcaagggatcctgagg
cgtcagctgggcgtgagtcccggtgaccaagccaacccgaatatccggacggaaacgcag
acgctggcgctcggcggttcataccagaatttcaggaccatgcagaccaacccgcacggt
tccgcgcacgtcaactattttggcggcagcatctcgtcaattccgacggccgccaaggat
ccgctgtttttcctgctgcactgcaatgtcgacaggttgtgggccaaatggcagtcccag
gtggggcggtacgatgcgaatgtggcggctgcctatgaatccaagcccaatccgccgaac
tggctcgctggtcacaatctcaacgatacgctgtggccgtggaatggcatcgtgacgccg
ccccgaccgtcgaccgcgcccggcggccccatggctgattcgtcttgcgtcccggcgcct
gggcggcatcctcaggtcagcgacatgcttgatttccagggggtggtgaacagttcggca
aagcttggctttgcctatgacgatgtgccctcgccctga

DBGET integrated database retrieval system