KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11506Help
Entry
RCFBP_11506       CDS       T01272                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RCFBP_11506 (folP)
Enzymes [BR:rsc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RCFBP_11506 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1540739..1541602
Genome map
AA seq 287 aa AA seqDB search
MSTTTHFQCGRFRYARDRRPLIMGILNVTPDSFSDGGEHATRDAALRHAELLMAEGADLI
DIGGESSRPGAAPLGLQEELDRVMPIVEALRDCGRPLSIDTYKPEVMRATLDAGADLIND
IWGFRRPGAIEAVAQGHAGLCLMHMQRDPETMQEAPSYTDLMAEVEGFLQTQAEALLAAG
VSAERIALDPGFGFGKTPDHNLIMLNRLERFKRMGLPLLVGLSRKSTLGAVLGGKPPAER
VAASVAAALLAAERGAFIVRVHDVRPTAEAIQLWWAMRHERVDPPVA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacgacccatttccagtgcggacgcttccgctatgcgcgcgaccggcgcccg
ctgatcatgggcatcctcaacgtcacgcccgattcgttttccgatggcggcgagcatgcc
acccgcgatgccgccttacgccatgccgagttgctgatggccgaaggggccgatctcatc
gacatcggcggcgagtcgagccggccgggggccgcaccgcttgggctgcaggaggaactg
gatcgggtgatgccgatcgtcgaggcgctgcgcgattgcggcaggccgctgtcgatcgac
acctacaagccggaggtgatgcgcgccacgctcgatgccggtgccgacctgatcaacgat
atctggggattccgcaggccgggcgcgatcgaggccgtcgcacagggccatgccgggctg
tgcctgatgcacatgcagcgcgatcccgaaacgatgcaggaagcccccagctataccgac
ctgatggccgaagtcgaggggttcctgcaaacgcaggctgaggccttgctggcagcgggc
gtctcggccgagcgtattgcgctggacccgggatttggctttggaaagacgccggaccac
aatctgatcatgctcaaccggctggagcgcttcaagcggatggggctgccgctgctggtg
ggcctgtcgcgcaagtcgacgctgggcgctgttctgggtggcaagccgccggccgagcgc
gtggcggcgagcgtggcggcggcgctgttggccgcagagcggggggccttcatcgtgcgc
gtgcacgacgtgcggccgaccgccgaagccatccagctctggtgggccatgcggcacgag
cgtgtggatccgccggtggcatga

DBGET integrated database retrieval system