KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11607Help
Entry
RCFBP_11607       CDS       T01272                                 

Gene name
pdhB
Definition
dihydrolipoyllysine-residue succinyltransferase, component of pyruvate dehydrogenase complex (e2) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCFBP_11607 (pdhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCFBP_11607 (pdhB)
   00020 Citrate cycle (TCA cycle)
    RCFBP_11607 (pdhB)
   00620 Pyruvate metabolism
    RCFBP_11607 (pdhB)
Enzymes [BR:rsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RCFBP_11607 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1656491..1658164
Genome map
AA seq 557 aa AA seqDB search
MSQVVEIKVPDIGDYKDVPVIEVHVKAGDPVNAEDSLVTLESDKATMDVPSPKSGIVKEL
KIKVGDAVSEGTLVLLLEEQGAAAAPAPQAAPAPAAAAPAPVVQAPAPAPAAQPAAGGGT
IDVKVPDIGDYKDVPVIEINVKVGDKVEAEQSLIMLESDKATMDVPSPAAGTVKDIRVKV
GDAVSEGTLIVVLEGAGAAAAAPTPAPAQVSAPAPVAAAPSPAPVVPAAAPAAAPATYTA
DTVGTVGKAAHASPSVRKYARELGVDVNLVGGTGPKNRITQDDVQRYVKGVMTGQAAAPG
KAAAAASAPAGGGELNLLPWPKVDFTKFGPVEPKPLSRIKKISGANLHRNWVMIPHVTNN
DEADITELEAFRVQMNKEHEKAGVKFTMLAFVIKAVVGALKKFPTFNASLDGDNLVFKQY
YHVGFAADTPNGLMVPVIRDADKKGVVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSL
GGIGGTHFTPIINAPEVAILGLSRGYQKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAAR
FNAYLAAVLADFRRVLL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtcgtagaaatcaaggtgccggacatcggcgactacaaggacgtgccggtc
atcgaggtgcacgtcaaggcgggcgatcccgtcaacgccgaggattcgctggtcacgctg
gaatcggacaaggcgaccatggatgtgccgtcgcccaagagcggcatcgtcaaggagctg
aagatcaaggtgggcgacgccgtctcggaaggcacgctggtgctgctgctcgaagagcag
ggcgcggcggcagccccggcgccccaggccgctccggctccggccgcagcggctcccgcg
ccggtggtgcaggcccccgcgcccgcgccggcggcccagcccgcggcaggtggcggcacg
atcgacgtgaaggtgccggacatcggcgactacaaggacgtgccggtcatcgagatcaac
gtgaaggtgggcgacaaggtggaagccgagcagtcgctgatcatgctcgaatccgacaag
gccacgatggatgtgccgtcgccggcggccggcacggtcaaggacatccgcgtgaaggtg
ggcgatgccgtgtcggaaggcacgctgatcgtcgtgctggaaggtgctggcgccgccgcc
gccgctccgacgcccgcgccggcacaagtatccgcaccggctccggtcgccgctgcgccg
agcccggctccggtggttcccgcagccgcgccggctgcagcgccggccacgtacaccgcc
gacaccgtcggcacggtgggcaaggccgcgcacgccagcccctcggtgcgcaagtacgcg
cgcgaactgggcgtggacgtgaacctggtcggcggcaccggcccgaagaaccgcatcacg
caggacgacgtgcaacgctacgtcaagggcgtgatgaccggccaggccgcagcgccgggc
aaggccgccgctgcagcctcggcaccggccggcggcggcgaactgaacctgctgccgtgg
ccgaaggtggacttcaccaagttcggcccggtcgagcccaagccgctgtcgcgcatcaag
aagatttccggcgcgaacctgcatcgcaactgggtcatgatcccgcacgtcaccaacaac
gacgaagcggacatcaccgagctggaagccttccgcgtgcagatgaacaaggagcacgag
aaggccggcgtgaagttcaccatgctggcgttcgtgatcaaggcggtcgtgggcgcgctc
aagaagttcccgaccttcaacgccagcctggacggcgacaacctggtcttcaagcagtac
taccacgttggcttcgctgccgacacgcccaacgggctgatggtgccggtgatccgcgac
gccgacaagaagggtgtggtggacatcgccaaggaaatggccgagctgtccaaggccgcc
cgcgaaggcaagctcaagccggaccagatgcagggcggctgcttctcgatctcgtcgctg
ggcggcatcggcggcacgcatttcacgccgatcatcaatgcgccggaagtggccatcctg
ggtttgtcgcgcggctatcagaagccggtgtgggacggcaagcaattcgtgccgcgcctg
acgctgccgctgtcgctgtcgtacgatcaccgcgtgatcgacggcgcggaagccgcacgc
ttcaatgcgtacctggcggccgtgctggcggacttccgccgcgtgctgctgtaa

DBGET integrated database retrieval system