KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11607Help
Entry
RCFBP_11607       CDS       T01272                                 

Gene name
pdhB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase, component of pyruvate dehydrogenase complex (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00010  Glycolysis / Gluconeogenesis
rsc00020  Citrate cycle (TCA cycle)
rsc00620  Pyruvate metabolism
rsc01100  Metabolic pathways
rsc01110  Biosynthesis of secondary metabolites
rsc01120  Microbial metabolism in diverse environments
rsc01130  Biosynthesis of antibiotics
rsc01200  Carbon metabolism
Module
rsc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCFBP_11607 (pdhB)
   00020 Citrate cycle (TCA cycle)
    RCFBP_11607 (pdhB)
   00620 Pyruvate metabolism
    RCFBP_11607 (pdhB)
Enzymes [BR:rsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RCFBP_11607 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 NQRA RnfC_N HlyD_3 DEC-1_N DUF4813
Motif
Other DBs
NCBI-ProteinID: CBJ42898
UniProt: D8NIM6
Position
1656491..1658164
Genome map
AA seq 557 aa AA seqDB search
MSQVVEIKVPDIGDYKDVPVIEVHVKAGDPVNAEDSLVTLESDKATMDVPSPKSGIVKEL
KIKVGDAVSEGTLVLLLEEQGAAAAPAPQAAPAPAAAAPAPVVQAPAPAPAAQPAAGGGT
IDVKVPDIGDYKDVPVIEINVKVGDKVEAEQSLIMLESDKATMDVPSPAAGTVKDIRVKV
GDAVSEGTLIVVLEGAGAAAAAPTPAPAQVSAPAPVAAAPSPAPVVPAAAPAAAPATYTA
DTVGTVGKAAHASPSVRKYARELGVDVNLVGGTGPKNRITQDDVQRYVKGVMTGQAAAPG
KAAAAASAPAGGGELNLLPWPKVDFTKFGPVEPKPLSRIKKISGANLHRNWVMIPHVTNN
DEADITELEAFRVQMNKEHEKAGVKFTMLAFVIKAVVGALKKFPTFNASLDGDNLVFKQY
YHVGFAADTPNGLMVPVIRDADKKGVVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSL
GGIGGTHFTPIINAPEVAILGLSRGYQKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAAR
FNAYLAAVLADFRRVLL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtcgtagaaatcaaggtgccggacatcggcgactacaaggacgtgccggtc
atcgaggtgcacgtcaaggcgggcgatcccgtcaacgccgaggattcgctggtcacgctg
gaatcggacaaggcgaccatggatgtgccgtcgcccaagagcggcatcgtcaaggagctg
aagatcaaggtgggcgacgccgtctcggaaggcacgctggtgctgctgctcgaagagcag
ggcgcggcggcagccccggcgccccaggccgctccggctccggccgcagcggctcccgcg
ccggtggtgcaggcccccgcgcccgcgccggcggcccagcccgcggcaggtggcggcacg
atcgacgtgaaggtgccggacatcggcgactacaaggacgtgccggtcatcgagatcaac
gtgaaggtgggcgacaaggtggaagccgagcagtcgctgatcatgctcgaatccgacaag
gccacgatggatgtgccgtcgccggcggccggcacggtcaaggacatccgcgtgaaggtg
ggcgatgccgtgtcggaaggcacgctgatcgtcgtgctggaaggtgctggcgccgccgcc
gccgctccgacgcccgcgccggcacaagtatccgcaccggctccggtcgccgctgcgccg
agcccggctccggtggttcccgcagccgcgccggctgcagcgccggccacgtacaccgcc
gacaccgtcggcacggtgggcaaggccgcgcacgccagcccctcggtgcgcaagtacgcg
cgcgaactgggcgtggacgtgaacctggtcggcggcaccggcccgaagaaccgcatcacg
caggacgacgtgcaacgctacgtcaagggcgtgatgaccggccaggccgcagcgccgggc
aaggccgccgctgcagcctcggcaccggccggcggcggcgaactgaacctgctgccgtgg
ccgaaggtggacttcaccaagttcggcccggtcgagcccaagccgctgtcgcgcatcaag
aagatttccggcgcgaacctgcatcgcaactgggtcatgatcccgcacgtcaccaacaac
gacgaagcggacatcaccgagctggaagccttccgcgtgcagatgaacaaggagcacgag
aaggccggcgtgaagttcaccatgctggcgttcgtgatcaaggcggtcgtgggcgcgctc
aagaagttcccgaccttcaacgccagcctggacggcgacaacctggtcttcaagcagtac
taccacgttggcttcgctgccgacacgcccaacgggctgatggtgccggtgatccgcgac
gccgacaagaagggtgtggtggacatcgccaaggaaatggccgagctgtccaaggccgcc
cgcgaaggcaagctcaagccggaccagatgcagggcggctgcttctcgatctcgtcgctg
ggcggcatcggcggcacgcatttcacgccgatcatcaatgcgccggaagtggccatcctg
ggtttgtcgcgcggctatcagaagccggtgtgggacggcaagcaattcgtgccgcgcctg
acgctgccgctgtcgctgtcgtacgatcaccgcgtgatcgacggcgcggaagccgcacgc
ttcaatgcgtacctggcggccgtgctggcggacttccgccgcgtgctgctgtaa

DBGET integrated database retrieval system