KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11675Help
Entry
RCFBP_11675       CDS       T01272                                 

Definition
(GenBank) putative lysophospholipase
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RCFBP_11675
Enzymes [BR:rsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RCFBP_11675
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RCFBP_11675
Lipid biosynthesis proteins [BR:rsc01004]
 Fatty acid synthase
  Component type
   RCFBP_11675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL Hydrolase_like Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: CBJ42965
UniProt: D8NIU3
Position
complement(1733813..1734457)
Genome map
AA seq 214 aa AA seqDB search
MLAAALGCVMIGVSPMSHAATEGSTPAPRRVVVLGDSLSAGYGLAQGTGWVALLGNRLKE
RKPDYSVANASISGDTTAGGRARLPAVLAREKPAVVVLELGANDALRGLSLSASEANLKA
MIEASQAAGARVLLVGMRIPPNYGPDYSERFFAMFGKLAQQYRLPLVPFLLDGVAQRPDW
FQEDRIHPVAAAQPTLLDNVWPKLEPLLKGRVGG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgcggccgcgctcggctgtgtgatgatcggcgtctcgccgatgtcgcacgctgcg
acggaaggctccacaccggcaccgcgccgcgtggtggtgctgggcgacagcctgtcagcg
ggatacggcctggcgcaaggcaccggctgggtcgcgctgctgggcaaccgcctgaaagaa
cggaagcccgattatagcgtcgccaatgccagcatcagcggcgacaccaccgcgggcggc
cgcgcccgcctgccggccgtgcttgcgcgcgagaagccggcggtagtggtactcgaactc
ggcgccaacgatgcgctgcgcgggctgtcgctgtccgccagcgaagccaatctgaaggcg
atgatcgaggcatcgcaggccgccggcgccagggtgctactggtcggcatgcgcatccca
cccaattacgggccggactatagcgaacgcttcttcgccatgttcggcaaactggcgcag
cagtacaggctgccgctggtgccgttccttctcgacggcgtggcccagcgacccgactgg
ttccaggaagaccgcatccacccggtcgcggcagcgcagccaacgctgctcgataacgtc
tggcccaagctcgaacctttactcaaaggccgggtcggaggatga

DBGET integrated database retrieval system