KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11805Help
Entry
RCFBP_11805       CDS       T01272                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase (Component e2 of pyruvate dehydrogenase complex) protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00010  Glycolysis / Gluconeogenesis
rsc00020  Citrate cycle (TCA cycle)
rsc00620  Pyruvate metabolism
rsc01100  Metabolic pathways
rsc01110  Biosynthesis of secondary metabolites
rsc01120  Microbial metabolism in diverse environments
rsc01130  Biosynthesis of antibiotics
rsc01200  Carbon metabolism
Module
rsc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCFBP_11805
   00020 Citrate cycle (TCA cycle)
    RCFBP_11805
   00620 Pyruvate metabolism
    RCFBP_11805
Enzymes [BR:rsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RCFBP_11805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: CBJ43094
UniProt: D8NJ72
Position
1852472..1853599
Genome map
AA seq 375 aa AA seqDB search
MIVFKLPDLGEGLQEAEIVQWHVQVGDTIEADQPLVSVETAKAIVEIPSPQAGRIARLFG
QPGDIVHLGAPLAAFEGAGGDVGAAADAGTVVGQMQVGQQVVREAPAVLAAAPGAAAGGI
KATPAVRALARKLDVDLSMVTPSGPDGVIAAADVERVAKVFAALGPPEVLRGVRRAMAQN
MARAQSEVAAATVIDDADIHAWPPGTDVTIRLIRALVAGCRAEPGLNAWFDGHAGRRHVL
EKIDLGIAVDLPDGLFVPVLRDVAHRDAADLRAGLDRMRADIKARKIPPEELRGNTITLS
NFGMIAGKYAAPVVVPPTVAILGAGRIHEQVVAAAGAPAVHRVLPLSLTFDHRVVTGGEA
ARFLAAAIADLEAER
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcttcaaactgccggacctcggcgaagggctgcaggaggcggagattgtgcaa
tggcacgtgcaggtcggcgacaccatcgaggccgaccagccgctggtctcggtcgagacc
gccaaggccatcgtcgagatcccgtcgccgcaggccggccgcatcgccaggctgttcggc
cagccgggcgacatcgtgcacctgggcgcgccgctggccgcgttcgaaggggcgggcggc
gatgtgggggcggcggcggatgcgggcaccgtggtcggccagatgcaggtcgggcagcag
gtggtgcgggaggcgccggccgtgctggccgccgcgcccggggcggccgccggcggcatc
aaggcgaccccggcggtgcgggcgctcgcgcgcaagctcgacgtggacctgtcgatggtg
acgccctcggggccggacggcgtgatcgcagcggcggatgtcgagcgggtggccaaggtg
ttcgccgcgctggggccgcccgaggtgctgcgcggcgtgcggcgcgccatggcccagaac
atggcccgcgcgcagagcgaggtggccgccgccaccgtcatcgatgacgccgacatccac
gcctggccgcccggcaccgacgtgaccatccgcctgatccgcgcgctggtggccggctgc
cgcgccgagcccggactcaatgcctggttcgatgggcatgcggggcggcgccatgtgctg
gagaagatcgatctcggcatcgccgtcgatctgcccgacgggctgttcgtgcccgtgctg
cgcgatgtcgcgcaccgcgacgcggccgacctgcgcgccgggctcgaccgcatgcgcgcc
gacatcaaggcccgcaagatcccgcccgaggagctgcgcggcaacaccatcacgctgtcg
aatttcggcatgatcgccggcaagtacgcggccccggtggtggtgccgccgaccgtggcg
atcctgggcgcgggccgcatccacgagcaggtggtggcggccgccggcgcgccggcggtg
caccgcgtgctgccgctgagcctgaccttcgaccaccgggtcgtgaccggcggcgaggcg
gcgcgtttcctggccgcggcaatcgcggacctggaggcggaacgatag

DBGET integrated database retrieval system