KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11805Help
Entry
RCFBP_11805       CDS       T01272                                 

Definition
dihydrolipoamide acetyltransferase (component e2 of pyruvate dehydrogenase complex) protein (EC:2.3.1.-)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCFBP_11805
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCFBP_11805
   00020 Citrate cycle (TCA cycle)
    RCFBP_11805
   00620 Pyruvate metabolism
    RCFBP_11805
Enzymes [BR:rsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RCFBP_11805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1852472..1853599
Genome map
AA seq 375 aa AA seqDB search
MIVFKLPDLGEGLQEAEIVQWHVQVGDTIEADQPLVSVETAKAIVEIPSPQAGRIARLFG
QPGDIVHLGAPLAAFEGAGGDVGAAADAGTVVGQMQVGQQVVREAPAVLAAAPGAAAGGI
KATPAVRALARKLDVDLSMVTPSGPDGVIAAADVERVAKVFAALGPPEVLRGVRRAMAQN
MARAQSEVAAATVIDDADIHAWPPGTDVTIRLIRALVAGCRAEPGLNAWFDGHAGRRHVL
EKIDLGIAVDLPDGLFVPVLRDVAHRDAADLRAGLDRMRADIKARKIPPEELRGNTITLS
NFGMIAGKYAAPVVVPPTVAILGAGRIHEQVVAAAGAPAVHRVLPLSLTFDHRVVTGGEA
ARFLAAAIADLEAER
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcttcaaactgccggacctcggcgaagggctgcaggaggcggagattgtgcaa
tggcacgtgcaggtcggcgacaccatcgaggccgaccagccgctggtctcggtcgagacc
gccaaggccatcgtcgagatcccgtcgccgcaggccggccgcatcgccaggctgttcggc
cagccgggcgacatcgtgcacctgggcgcgccgctggccgcgttcgaaggggcgggcggc
gatgtgggggcggcggcggatgcgggcaccgtggtcggccagatgcaggtcgggcagcag
gtggtgcgggaggcgccggccgtgctggccgccgcgcccggggcggccgccggcggcatc
aaggcgaccccggcggtgcgggcgctcgcgcgcaagctcgacgtggacctgtcgatggtg
acgccctcggggccggacggcgtgatcgcagcggcggatgtcgagcgggtggccaaggtg
ttcgccgcgctggggccgcccgaggtgctgcgcggcgtgcggcgcgccatggcccagaac
atggcccgcgcgcagagcgaggtggccgccgccaccgtcatcgatgacgccgacatccac
gcctggccgcccggcaccgacgtgaccatccgcctgatccgcgcgctggtggccggctgc
cgcgccgagcccggactcaatgcctggttcgatgggcatgcggggcggcgccatgtgctg
gagaagatcgatctcggcatcgccgtcgatctgcccgacgggctgttcgtgcccgtgctg
cgcgatgtcgcgcaccgcgacgcggccgacctgcgcgccgggctcgaccgcatgcgcgcc
gacatcaaggcccgcaagatcccgcccgaggagctgcgcggcaacaccatcacgctgtcg
aatttcggcatgatcgccggcaagtacgcggccccggtggtggtgccgccgaccgtggcg
atcctgggcgcgggccgcatccacgagcaggtggtggcggccgccggcgcgccggcggtg
caccgcgtgctgccgctgagcctgaccttcgaccaccgggtcgtgaccggcggcgaggcg
gcgcgtttcctggccgcggcaatcgcggacctggaggcggaacgatag

DBGET integrated database retrieval system