KEGG   Ralstonia solanacearum CFBP2957: RCFBP_20023Help
Entry
RCFBP_20023       CDS       T01272                                 

Gene name
dxr
Definition
1-deoxy-d-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rsc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1978684..1979865)
Genome map
AA seq 393 aa AA seqDB search
MMRITVLGATGSIGDSTLDVVRRHPDRYRVFALTANAQVDKLAALCRDFHPAMAVVGSAA
AAAALRDQLGAEAAGIDIRFGPEALEEAAAHPDCDAVMAAIVGAAGLRPTLAAVRAGKRV
LLANKEALVMSGALFMDAVRQHGATVLPIDSEHNAIFQCLPQQRPQFGRGVARIVLTASG
GPFRTRAIETLTEVTPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFNVPVEQLE
VLIHPQSVIHSMVAYDDGSVLAQLGNPDMRTPIAYGLAYPDRIEAGVPLLDLAATGTLAF
EAPDLHRFPCLALAFDALRAGGTAPAVLNAANEVAVEAFLQRRIRFTEIAAVVADTLAHT
AIGQADSLDTVFAADAQARRRAEHYIAASCVHS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcattaccgttcttggcgccaccggctccatcggcgacagcacgctcgacgtg
gtgcgccgccacccagaccgctaccgcgtgttcgcgctgaccgccaacgcgcaggtcgac
aagcttgctgcgctgtgccgagatttccatccggcgatggcggtggtcggctcggccgcc
gcggctgccgcgctgcgggaccagcttggcgcggaggccgccggcatcgacatccgtttc
ggccccgaagcgttggaagaggccgccgcccatcccgattgcgatgccgtgatggccgca
atcgtcggcgcagcgggcctgcgccccacgctggccgccgtgcgcgccggtaagcgcgtg
ctgctggccaacaaggaagcgctggtgatgtccggcgcgctcttcatggacgcggtgcgc
cagcacggtgccacggtgctgccgatcgacagcgagcacaacgccatcttccaatgcctg
ccccagcagcgcccgcagttcgggcgcggcgtggcgcgcatcgtgctgacggcttcgggc
ggcccgttccgcacgcgcgccatcgagacgctgaccgaggtcacgcccgagcaggcctgc
gcccacccgaactgggtgatgggccgcaagatttccgtcgactccgccaccatgatgaac
aaggggctggaggtgatcgaggcgcactggctgttcaacgtgccggtcgagcagctcgag
gtgctgatccacccgcagagcgtgatccattcgatggtcgcctacgacgacggctcggtc
ctggcgcagctcggcaaccccgacatgcggacgccgatcgcctacgggctggcctatccc
gatcgcatcgaggccggtgtgccgctgctggatctggccgcgaccggcacgcttgcgttc
gaggcgcccgacctgcaccgcttcccgtgcctggcgctggccttcgatgccctgcgcgcc
ggcggtacggcgcctgctgtgctgaatgcggccaacgaggtggcggtcgaggcatttttg
cagcgccgcatccgctttaccgagatcgccgcggtggtggccgatacgctggcgcacacc
gccattgggcaggcggattcgctcgacacggtgttcgccgccgatgcgcaggcgcgccgc
cgcgccgagcactatatcgccgcatcgtgcgttcattcgtga

DBGET integrated database retrieval system