KEGG   Ralstonia solanacearum CFBP2957: RCFBP_20067Help
Entry
RCFBP_20067       CDS       T01272                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCFBP_20067 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RCFBP_20067 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    RCFBP_20067 (aceB)
Enzymes [BR:rsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RCFBP_20067 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2029811..2031400)
Genome map
AA seq 529 aa AA seqDB search
MATMELTLPQGMEIKAEILPAYEDILTPDALALVARLHRAFEPRRRQLLAARAERAKRLD
AGERPDFLPETRHIREGDWTIAKIPPALECRRVEITGPVDAKMVINAFNSGADSYMTDFE
DSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYKLNDKIATLQVRPRGWHLDEKHVTVD
GQRVSGGIFDFALFFFHNAKEQLARGAGPFFYLPKMESHLEARLWNDVFIAAQQALSLPQ
GTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKMDKNFCLADRAK
VTMTSPFMRAYALLLLKTCHKRGAPAMGGMSALIPIKNDPEKNAIAMQGIISDKKRDATD
GYDGGWVAHPGLVEAAMKEFVDVLGEAPNQIGKQRPDVSVAAADLLNFQPEQPITEAGLR
MNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLDDGTKVTAEL
VRKLIPEELAKVKADGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccatggagctgacgctgccccagggcatggagatcaaggccgagatcctgccg
gcctatgaagacattctgacccccgatgccctggccctcgtcgcccggctgcaccgggcc
ttcgagccgcgccgccggcaactgctggccgcccgcgccgagcgcgccaagcgcctggac
gctggtgagcgcccggacttcctgcccgagacccggcacatccgcgagggcgactggacc
atcgccaagattccgcccgccctggaatgccgccgcgtggagatcaccggcccggtcgac
gccaagatggtcatcaacgcgttcaactcgggcgcggacagctacatgaccgacttcgag
gattcgaacgccccgagctggcacaaccagatccagggccaggtcaacctgaaggcggcc
atccgccgcacgctcacgctggagtcgggcggcaagtcctacaagctcaacgacaagatc
gccacgctgcaggtgcgcccgcgcggctggcacctcgacgagaagcacgtgacggtggac
ggccagcgcgtctcgggcggcatcttcgacttcgcgctgttcttcttccacaacgcgaag
gaacagctcgcgcgcggcgccggcccgttcttctacctgccgaagatggagagccacctg
gaggcgcgcctgtggaacgatgtcttcatcgccgcacagcaggcgctcagcctgccgcag
ggcaccatcaaggccaccgtgctgatcgagaccatcctcgccgcgttcgagatggacgag
atcctgtacgaactgcgcgagcacagcgccggcctgaacgccggccgctgggactacatc
ttctcgtgcatcaagaagttcaagatggacaagaacttctgcctggccgaccgcgccaag
gtcacgatgacctcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccac
aagcggggcgcgccggccatgggcggcatgagcgcgctgatcccgatcaagaacgatccg
gagaagaacgccatcgccatgcagggcatcatcagcgacaagaagcgcgacgccaccgac
ggctacgacggcggctgggtggcgcacccgggcctggtcgaggcggccatgaaggagttc
gtggacgtgctgggcgaggcccccaaccagatcggcaagcagcgccccgacgtgagcgtg
gcggccgccgacctgctgaacttccagcccgagcagcccatcaccgaggccggcctgcgc
atgaacatcaacgtcggcatccactacctgggcgcctggctggccggcaacggctgcgtg
ccgatccacaacctgatggaagacgcggccacggccgagatctcacgctcccaggtgtgg
cagtggatccgctcgcccaagggcacgctggatgacggcaccaaggtcacggccgagctg
gtgcgcaagctgatcccggaagagctggccaaggtgaaggcggacggcgcggtgggccac
ttcgatcgcgccgcgcagatcttcgagcagatgtcgacgtcggagtccttctccgaattc
ctgacgctgccgctgtacgaagaaatctga

DBGET integrated database retrieval system