KEGG   Ralstonia solanacearum CFBP2957: RCFBP_20098Help
Entry
RCFBP_20098       CDS       T01272                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCFBP_20098 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCFBP_20098 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RCFBP_20098 (thrC)
Enzymes [BR:rsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RCFBP_20098 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2062276..2063727)
Genome map
AA seq 483 aa AA seqDB search
MSMQYRSTRGHAEPQSFSRILLGGLAPDGGLYLPEQYPQVSVEELTRWRDLPYADLAFEI
LRKFATDIPEDDLRALARRTYTPEVYCNARTGDSTADITPLHRMGEEGGTSLSLLCLSNG
PTLAFKDMAMQLLGNLFEYALDREHAELNILGATSGDTGSAAEYAMRGKRGVRVFMLSPH
RKMSAFQTAQMFSLQDQNIFNIAIEGVFDDAQDIVKAVSNDLEYKARQKIGTVNSINWAR
VVAQVVYYFKGYLLAAPKIGDKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDV
LDEFFRTGTYRVRSAAQTYHTSSPSMDISKASNFERFVFDLLERDPARLAQLFHDVEEKG
GFSLTGKPEFDRIAAFGFVSGRSTHEDRVNTIRDVFARYGTMIDTHTADGVKVAREHLSP
GVPMVVLETALPAKFGDTIREALDREPERPAGYADIESLPQRFEVMPADADRVKAYIVQH
TGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcaataccgatccacgcgcggccacgctgagccgcagagcttttcccgcatc
ctgctgggcggcctggcgccggacggcggcctgtacctgcccgagcagtacccgcaagtc
agcgtcgaagaactgacccgctggcgcgacctgccgtacgccgatctcgcgttcgagatc
ctgcgcaagttcgccaccgacatccccgaggatgatctgcgcgcgctggcccgccgcacc
tacacgcccgaggtctattgcaacgcgcgtaccggcgacagcaccgccgacatcacgccg
ctgcaccgcatgggcgaagaaggcggcacgtcgctgtcgctgctgtgcctgtccaacggc
ccgacgctggccttcaaggacatggcgatgcagctgctgggcaacctgttcgaatacgcg
ctcgaccgcgagcatgccgaactgaacatcctgggcgccacctccggcgataccggcagc
gcggccgaatacgccatgcgcggcaagcgcggcgtgcgcgtgttcatgctgagcccgcac
cgcaagatgagtgcgttccagaccgcgcagatgttcagcctgcaggaccagaacatcttc
aacatcgctatcgagggcgtgttcgacgacgcgcaggacatcgtcaaggccgtctcaaac
gacctggagtacaaggcccgccagaagatcggcacggtcaactcgatcaactgggcgcgc
gtggtggcgcaagtcgtttactacttcaagggttacctgctggctgccccgaagatcggc
gacaaggtgtcgttctgcgtgccgtcgggcaacttcggcaatgtctgcgcgggccacatc
gcacgcatgatgggcctgccgatcgacaagctggtggtcgccaccaacgagaacgacgtg
cttgacgagtttttccgcaccggcacctaccgcgtgcgctcggcggcgcagacgtaccac
acgtccagcccgagcatggacatctccaaggcgtccaacttcgagcgcttcgtgttcgac
ctgctggagcgcgatccggcgcgcctggcgcaactcttccacgacgtggaggagaagggc
ggcttctcgctgacgggcaagccggagttcgatcgcatcgccgcgtttggcttcgtgtcg
ggccgcagcacgcacgaagaccgcgtcaacaccatccgcgacgtgttcgcgcgctacggc
acgatgatcgacacgcacaccgccgacggcgtcaaggttgcgcgcgagcatctgtcgccc
ggcgtgccgatggtggtgctggagaccgcgctgccggccaagttcggcgacaccattcgc
gaggcgctggaccgcgagccggagcgcccggccggttacgccgacatcgaatcgctgccg
cagcgcttcgaggtgatgccggccgatgcggatcgcgtgaaggcgtacatcgtccagcac
accggcctgtaa

DBGET integrated database retrieval system