KEGG   Ralstonia solanacearum CFBP2957: RCFBP_20522Help
Entry
RCFBP_20522       CDS       T01272                                 

Gene name
folA
Definition
dihydrofolate reductase type I (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RCFBP_20522 (folA)
   00670 One carbon pool by folate
    RCFBP_20522 (folA)
Enzymes [BR:rsc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     RCFBP_20522 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2487299..2487802
Genome map
AA seq 167 aa AA seqDB search
MTLLTLIVARARNGVIGRDNTLPWRLPEDLAHFKRTTMGAPIVMGRKTYESIGRPLPGRR
NIVVTRNAGLALPGCEVAHSLEDAQRLCIGVEQIFLIGGAQLYADALPSADRLIVTEIDA
DFEGDARFPAPDPAVWHEVARETHHAAPPNDFDYAFVTYERPPSGEQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacccttctcacgctcatcgtcgcccgggcccgcaacggcgtgatcggccgcgacaac
acgctgccctggcgcctgcccgaagacctggcgcacttcaagcgcaccaccatgggcgcg
cccatcgtgatgggccgcaagacatatgaatcgatcggccggccgctgccgggccgccgc
aatatcgtcgtcacgcgcaacgccggactggcactgcccggctgcgaggtcgcgcattcg
ctcgaagatgcgcagcggctatgcatcggcgtcgagcagatcttcctgatcgggggcgcg
cagttgtatgccgatgccctgccgagcgccgaccggctgatcgtcaccgagatcgacgcc
gacttcgagggcgacgcacgattcccggcgcccgaccccgcggtctggcacgaagtcgcg
cgcgaaacccaccacgccgcgccgcccaacgacttcgactacgccttcgtcacctacgag
cggccgccgtcgggcgaacaataa

DBGET integrated database retrieval system