KEGG   Ralstonia solanacearum CFBP2957: RCFBP_20647Help
Entry
RCFBP_20647       CDS       T01272                                 

Definition
(GenBank) putative Beta-hexosaminidase A precursor
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00520  Amino sugar and nucleotide sugar metabolism
rsc01100  Metabolic pathways
rsc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RCFBP_20647
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    RCFBP_20647
Enzymes [BR:rsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RCFBP_20647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: CBJ43834
UniProt: D8NML8
Position
complement(2609742..2611796)
Genome map
AA seq 684 aa AA seqDB search
MGLVALSLAACSPDDETASDTQLKAQALQIVGQMSTRDKIGQKIMMAFRYWCEPPANANC
TDRMTVLPDAAAGALRDHRIGGVILFANNLVSIDQINRLTAQIAAAAPVGMLIGVDEEGG
NVFRLPRGSATSFPGSMALGAAYLGTADAALAYGQGHVLASELAAVGMNVNFAPVVDVNS
NPLNPVINVRAYGDDPDMVGLLGRDMARGMAHAGVISAFKHFPGHGDAATDSHYGLPRVD
KSRADAYATDLAPYRTSIDLGEAPEMIMTAHIQYPSLDATRIATRTGESILVPATMSRKI
QHDLLRGELGYRGVTVSDALDMDAIANHFDPDQAVINLFRADVDIALMPVEVRTADQAGR
LGALIDRVVAALDAGTLSRAELDASVARIVQMKLRYGIVPNAPRPRTSAAVSIGSPSHRA
VEQRIAQASITLLRNRSATLPLNAPQRPVFIMTPWGEQAQGMRRRFAELGYGSVTGAKLA
ETSWAEQQRLIDAADIVILGTLSSGPSPVERNGDPRAADARTNTAAVQARAARPAGDPAS
RATAAKRPEAIAQGQGSLVFNVEEDGPVVSGALRTQQIAAPSEAQQMRYAMEYAKAKGKT
VIHVSLRAPYDVPSFDDVADATVAAYAYYGYDNGVWRGPSMPALVDALAGVRSPLGRLPV
SVYEVNPDGTLGSLRYARGFGMRY
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
ctggggctggtggcgctctcgttggccgcgtgctcgcctgacgatgaaaccgccagcgac
acgcagttgaaggcgcaggcgctgcagatcgtcgggcagatgtcgacgcgcgacaagatc
gggcagaagatcatgatggcgttccgctactggtgcgagccgccggccaatgccaactgc
acggaccgcatgacggtgctgcccgacgccgccgccggcgcgctgcgcgatcaccgcatc
ggcggcgtgatcctgtttgccaacaatctcgtgtcgatcgatcagatcaaccgcctgacg
gcgcagatcgctgcggcggcgccggtcggcatgctgatcggcgtcgatgaggagggcggc
aacgtgttccggttgccgcgcggcagtgcgacgtcgttccccgggagcatggcgctcggg
gccgcctacctggggactgccgacgcggcactcgcctacggccaggggcacgtgctcgcc
tctgagctggcggcggtcggcatgaacgtcaactttgcgccggtggtcgacgtcaacagc
aatccgctgaatcccgtcatcaacgtgcgtgcctacggcgatgatccggacatggtcggc
ctgctcggccgcgatatggcgcgcggcatggcccacgcgggcgtcatcagcgccttcaag
cacttcccgggccacggggatgcggcaaccgattcgcactatgggctgccgcgtgtggac
aagtcgcgtgccgacgcgtacgcgaccgacctcgcgccgtatcgcacatcgatcgacctg
ggcgaagcgccggagatgatcatgaccgcgcatatccagtatccgtcgctcgacgcaacc
cggatcgcgacgcgtaccggcgagtccatcctcgtgccggccaccatgtcgcgcaagatc
cagcacgacctgctgcgcggcgagctcggctaccgcggcgtgacggtctccgatgcgctc
gacatggatgcaatcgcgaaccacttcgatcccgatcaggcggtgatcaacctgtttcgc
gccgatgtcgacatcgcgctgatgcccgtcgaggtccgcacggccgaccaggccggccgg
ctcggtgcgctgatcgatcgcgtcgtggcggcgctggatgccggcacgctgagccgggcc
gaactggatgcgtcggtcgcgcgcatcgtacagatgaagctgcgctacgggatcgtaccg
aacgcgccgcggccgcggacgtccgccgccgtgtcgatcggcagccccagccatcgggcg
gtcgagcagcgcattgcgcaggcatcgatcacgctcttgcgcaatcgcagcgcgacgctg
ccgctgaacgcgccgcaacggccggttttcatcatgacgccctggggcgagcaggcccag
gggatgcgccggcgctttgctgaactcggctacggttcggtgaccggcgcgaagctggcg
gaaacgtcctgggccgagcagcagcggctgatcgatgcggccgacatcgtgattctcggg
accctgtcgagcggcccttcgccggtcgagcgcaacggcgatccgcgcgcggccgatgcg
cggacgaacaccgccgcggtgcaagcgcgcgccgcacggcccgccggcgatccggcatcg
cgcgccacggcggccaagcgccccgaggccatcgcgcaggggcaaggctcgctggtcttc
aacgtcgaggaagacgggccggtggtgtcgggggcgctgcgcacgcagcagatcgccgcg
cccagcgaagcgcagcagatgcgctacgcgatggagtatgccaaggcgaagggcaagacc
gtcatccacgtatcgctgcgcgcgccgtacgatgtgccttcgttcgacgatgtggccgac
gcgacggtcgccgcctatgcgtactacggctatgacaacggcgtctggcgcggcccgtcg
atgccggcgctggtcgatgcgctggccggcgtgcgctcgccgctgggccgtctgccggtt
tcggtgtacgaggtaaacccggacggcacgctgggttcactgcggtacgcgcgcggcttc
gggatgcgctactga

DBGET integrated database retrieval system