KEGG   Ralstonia solanacearum CFBP2957: RCFBP_20717Help
Entry
RCFBP_20717       CDS       T01272                                 

Gene name
pcm
Definition
protein-l-isoaspartate o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rsc  Ralstonia solanacearum CFBP2957
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2675638..2676378
Genome map
AA seq 246 aa AA seqDB search
MTIRAGMSSGLAKMPGLSTNPHSLRIEGMPMDIEKSRFNMIEQQIRPWDVLDLDVLDLLA
IVKREQYVPEAYRALAFVDMEIPLPGGQNMLPPRVEARVLQELAVRKHEDVLEVGAGSGY
MAALLAHRGRHVTTVDIAPELVAFARDNLARNGVTNADVAEGNAALGWGNSLYDVICVSG
SVPAVPESLLMQLKVGGRLSIFVGGAPVMEAQLITRVSEAEFQTRNLFETYVTPLVGVPV
PSQFRF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccgcgccggaatgtcctccggacttgctaaaatgcccggtttgtcgacaaac
cctcattcgctccgcatcgaaggcatgcccatggacatcgaaaaatcccggttcaacatg
atcgagcaacagatccgcccgtgggatgtgctcgacctcgacgtgctcgacctgctggcc
atcgtcaagcgcgagcaatacgtgcccgaggcttaccgcgcgctggccttcgtcgacatg
gagattccgctgcccggcggccagaacatgctgcccccacgcgtggaagcccgcgtgctg
caggagctggccgtgcgcaagcacgaagacgtgctcgaggtcggcgcaggttcgggctac
atggctgcgctgctggcccatcgcggccgccatgtcaccaccgtggacatcgcgcccgaa
ctggttgccttcgcgcgcgacaacctcgcccgcaacggcgtgaccaacgccgacgtggcc
gagggcaacgcagccctgggctggggcaacagcctgtacgacgtcatctgcgtatcgggc
tcggtgccggcggtaccggaatccctgctcatgcaactgaaggtcggcggccgcctgtcg
atcttcgtgggcggcgcgccggtcatggaagcgcagctgatcacgcgcgtgtccgaggcc
gaattccagacccgcaacctgttcgagacctatgtgacgccgctggtgggtgtgcccgtg
ccgtcgcagttccgcttctaa

DBGET integrated database retrieval system