KEGG   Ralstonia solanacearum CFBP2957: RCFBP_20723Help
Entry
RCFBP_20723       CDS       T01272                                 

Gene name
cpsG
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCFBP_20723 (cpsG)
   00030 Pentose phosphate pathway
    RCFBP_20723 (cpsG)
   00051 Fructose and mannose metabolism
    RCFBP_20723 (cpsG)
   00052 Galactose metabolism
    RCFBP_20723 (cpsG)
   00500 Starch and sucrose metabolism
    RCFBP_20723 (cpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    RCFBP_20723 (cpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    RCFBP_20723 (cpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RCFBP_20723 (cpsG)
Enzymes [BR:rsc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RCFBP_20723 (cpsG)
    5.4.2.8  phosphomannomutase
     RCFBP_20723 (cpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2681452..2682837)
Genome map
AA seq 461 aa AA seqDB search
MQIDPSIFKAYDIRGIVGKNVDRETARLIGRAFGSAARANGEAAVVIGRDGRLSGPDLVA
GLAEGLRQSGVDVIDLGLVATPMVYFGTHIELAGRRATSGVMVTGSHNPPDYNGFKMVLA
GQAIYGEQIQALRQRIEQRDFTEGAGAYVQVDVRQQYIDRIVSDVKMARPMKIAVDCGNG
VAGAFAPALFRAMGCEVTELFCEVDGHFPNHHPDPAHVENLQDLVRTLQTTDCELGLAFD
GDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRHPGGEIIFDVKCTGKLAPFIREHGGKAT
MWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEILSRHADPSTV
LNALPNSHCTPELQLKCAEGEPFALLDRIKANATFDGAKEVNRIDGVRVEYADGFGLARP
SNTTPVVVMRFEADNDAAMARIQSEFRRVILAEKPDATLPF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgacccctccatcttcaaggcctatgacattcgcggcatcgtcggcaagaac
gtcgaccgtgaaaccgcgcggctgatcggccgggccttcggttcggcggcgcgcgccaac
ggcgaggccgccgtggtgatcggccgcgatggccgcttgtccggcccggatctcgtcgcg
ggcctggccgagggcctgcgccagagcggggtggacgtgatcgacctcgggctggtggcc
acgccgatggtctactttggcacccatatcgaactggccggccgccgcgccacgtccggc
gtgatggtcaccggcagccacaacccgcccgactacaacggcttcaagatggtgctggcg
ggccaggccatctacggcgagcagatccaggcgctgcgccagcgcatcgagcagcgcgat
ttcaccgagggcgccggcgcgtatgtccaggtggacgtgcgccagcagtacatcgatcgc
atcgtctccgacgtcaagatggcacggccgatgaagatcgccgtggactgcggcaacggc
gtggcgggcgctttcgcgccagcgctgttccgcgccatgggctgcgaggtgacggagctg
ttctgcgaggtggacggccacttcccgaaccaccatccggacccggcccacgtcgagaat
ctgcaggacctcgtgcgcacgctgcagaccaccgactgcgaactcggcctggccttcgat
ggcgatggcgaccgcctcggcgtggtcaccaaggacggccaggtgatcttcccggatcgc
caactgatgctgttcgcgcaggaggtgctgtcgcgccacccgggcggcgagatcatcttc
gacgtgaagtgcaccggcaaactggcaccgttcattcgcgagcacgggggcaaggccacg
atgtggaagacggggcactcgctggtcaaggccaagctgaaggaaaccggtgcgccgctg
gccggcgagatgagcggccatatcttcttcaaggatcgctggtacggcttcgacgacggt
ctctatactggcgcccgcctgctggagatcctgtcgcgccatgccgatccgagcaccgtg
ctgaacgcactgccgaattcgcattgcacgcccgagctgcagctcaagtgcgccgagggc
gagccgttcgcgctgctcgacaggatcaaggcgaacgcgaccttcgatggtgcgaaggaa
gtgaaccgcatcgacggcgtgcgcgtggagtatgccgatggctttggcctggcgcgcccg
tccaataccaccccggtggtggtgatgcgtttcgaggctgacaacgatgccgccatggca
cgcatccagagtgagttccgccgcgtgatcctggccgagaagccggacgcgacgctgccg
ttctga

DBGET integrated database retrieval system