KEGG   Ralstonia solanacearum CFBP2957: RCFBP_21092Help
Entry
RCFBP_21092       CDS       T01272                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RCFBP_21092 (ispE)
Enzymes [BR:rsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RCFBP_21092 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3041811..3042680
Genome map
AA seq 289 aa AA seqDB search
MSSAPTELRDCPAPAKLNLFLHVVGRRPDGYHLLQTVFQLIDWCDTLHFGRRADARLVRT
TDIPGVPAEEDLVIRAARLLQAETGCAYGADIALEKRLPMGGGIGGGSSDAATTLLALNR
LWGLDLPRAKLMSLGLRLGADVPFFLFGQNAFAEGIGEELTPIALPPATFVVIHPRVHVP
TPEIFCDEGLTRDTPLTIITDFPDQQIVFAYGRNDLQAVAERKYGEIARALAWLRQFSPL
ARMTGSGACVFAPFDRAEQAQAVADQVPPEWEGRCAAGLTHHPLAMLAV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgcgcccaccgaactgcgcgactgccccgcgcccgccaagctcaacctgttc
ctgcacgtggtcggccgccggccggacggttaccacctgctgcagaccgtgttccagctg
atcgactggtgcgacacgctgcacttcggccgccgcgccgacgctcgcctggtgcgcacc
accgacatccccggcgttcccgcggaggaagacctggtcatccgcgccgcacgcctgctg
caagcggaaaccggctgcgcctacggcgccgatattgcactggagaagcgcctgccgatg
ggcggcggcatcggcggcggctcgtccgacgcagcgaccacgctgctggcgctcaaccgc
ctgtggggactcgatctgccacgcgcgaagctgatgtcgctgggcctgcgcctgggggcc
gacgtgcccttcttcctgttcggccagaacgcattcgccgaggggatcggcgaggaactg
accccgatcgcgttgccgccggcgaccttcgtggtcatccatccgcgtgtccatgtcccc
actcccgaaattttttgcgatgaagggttgacacgtgacactcccctcaccataattacg
gactttcctgaccaacaaattgttttcgcttacggtcgcaacgatctgcaagcggtggcg
gaaaggaaatacggcgaaatcgcccgagctcttgcctggctgcgtcaattcagccctctg
gcaaggatgaccggatccggcgcctgcgtgttcgcaccatttgatcgtgcggaacaggca
caagcggtggcggatcaggtgcctcccgaatgggagggtcggtgtgcggcaggtctgacg
catcacccgctcgcgatgttggctgtgtaa

DBGET integrated database retrieval system