KEGG   Ralstonia solanacearum CFBP2957: RCFBP_21134Help
Entry
RCFBP_21134       CDS       T01272                                 

Gene name
gpmA
Definition
phosphoglyceromutase 1 (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCFBP_21134 (gpmA)
   01230 Biosynthesis of amino acids
    RCFBP_21134 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCFBP_21134 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    RCFBP_21134 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCFBP_21134 (gpmA)
Enzymes [BR:rsc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RCFBP_21134 (gpmA)
Exosome [BR:rsc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RCFBP_21134 (gpmA)
  Exosomal proteins of melanoma cells
   RCFBP_21134 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3079465..3080220
Genome map
AA seq 251 aa AA seqDB search
MAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGIAQARQGGRLLREAGFTFDLAYTSV
LKRAIRTLWHVQDEMDLMWIPTRTEWRLNERHYGGLSGLNKGETAAQYGDEQVLVWRRSY
DTPPPALEAGDERDAYGDPRYAGLSREQVPLTECLKDTVARVLPLWETSIAPDIKSGKRV
VIAAHGNSIRALVKYLDNISDDDIVGLNIPNGTPLVYELDANLKPIRHYYLGDQEAIAAS
LAAVASQGKAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcatgcataagctcgtcctcatccgccacggcgaatcgacctggaacctcgaa
aaccgcttcaccggctgggtcgacgtcgacctgaccgacaccggcatcgcccaggcccgc
cagggcggccgcctgctgcgcgaagccggcttcaccttcgacctggcctacacctcggtg
ctcaagcgcgccatccgcacgctgtggcacgtgcaggatgaaatggacctgatgtggatc
ccgacccgcaccgaatggcgactgaacgagcgccactacggcggcctgtcgggcctgaac
aagggcgagaccgccgcccagtacggcgacgagcaggtgctggtctggcgccgcagctac
gacaccccgccgcccgcgctggaggccggcgacgagcgcgacgcgtacggcgacccgcgc
tatgcgggcctgtcgcgcgaacaggtgccgctcaccgaatgcctgaaggacaccgtggca
cgcgtgctgccgctgtgggaaacctcgatcgccccggacatcaagagcggcaagcgcgtc
gtgatcgccgcacacggcaacagcatccgcgccctcgtgaagtacctggacaacatctcg
gacgacgacatcgtcggcctgaacatccccaacggcaccccgctcgtctatgagctggac
gccaacctgaagcccatccgccactactacctcggcgaccaggaagcgatcgccgcgtcg
ctcgccgccgtggccagccagggcaaggcgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system