KEGG   Ralstonia solanacearum CFBP2957: RCFBP_21134Help
Entry
RCFBP_21134       CDS       T01272                                 

Gene name
gpmA
Definition
phosphoglyceromutase 1 (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rsc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsc00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:rsc00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rsc00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3079465..3080220
Genome map
AA seq 251 aa AA seqDB search
MAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGIAQARQGGRLLREAGFTFDLAYTSV
LKRAIRTLWHVQDEMDLMWIPTRTEWRLNERHYGGLSGLNKGETAAQYGDEQVLVWRRSY
DTPPPALEAGDERDAYGDPRYAGLSREQVPLTECLKDTVARVLPLWETSIAPDIKSGKRV
VIAAHGNSIRALVKYLDNISDDDIVGLNIPNGTPLVYELDANLKPIRHYYLGDQEAIAAS
LAAVASQGKAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcatgcataagctcgtcctcatccgccacggcgaatcgacctggaacctcgaa
aaccgcttcaccggctgggtcgacgtcgacctgaccgacaccggcatcgcccaggcccgc
cagggcggccgcctgctgcgcgaagccggcttcaccttcgacctggcctacacctcggtg
ctcaagcgcgccatccgcacgctgtggcacgtgcaggatgaaatggacctgatgtggatc
ccgacccgcaccgaatggcgactgaacgagcgccactacggcggcctgtcgggcctgaac
aagggcgagaccgccgcccagtacggcgacgagcaggtgctggtctggcgccgcagctac
gacaccccgccgcccgcgctggaggccggcgacgagcgcgacgcgtacggcgacccgcgc
tatgcgggcctgtcgcgcgaacaggtgccgctcaccgaatgcctgaaggacaccgtggca
cgcgtgctgccgctgtgggaaacctcgatcgccccggacatcaagagcggcaagcgcgtc
gtgatcgccgcacacggcaacagcatccgcgccctcgtgaagtacctggacaacatctcg
gacgacgacatcgtcggcctgaacatccccaacggcaccccgctcgtctatgagctggac
gccaacctgaagcccatccgccactactacctcggcgaccaggaagcgatcgccgcgtcg
ctcgccgccgtggccagccagggcaaggcgaaataa

DBGET integrated database retrieval system