KEGG   Ralstonia solanacearum CFBP2957: RCFBP_21184Help
Entry
RCFBP_21184       CDS       T01272                                 

Definition
glutathione peroxydase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RCFBP_21184
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RCFBP_21184
Enzymes [BR:rsc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RCFBP_21184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3128338..3129045
Genome map
AA seq 235 aa AA seqDB search
MSSPSIATPTLARTRDRLARRHAAGVLRRHHLLIIVIAIVIAIIALLLPRTGHAAVGTQA
APAPSPATATAGKCPAALDFRVKRLQDDAPQDLCQYAGRVVLVVNTASYCGYTYQYEGLE
ALYAKYRDKGLTVLGFPSNDFEQEPGTGKQIASFCYNTYGVKFPMFSKTSVVGPAASPLY
HWLTRQTGQPPKWNFHKYLLDRSGRVVAVYPSRIEPSDPAIVNRIDTLLAEPAPR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgccttccatcgccacgcccacgcttgcccgcacacgcgaccggctcgcccgc
cggcacgccgcgggcgtgctgcgccggcatcacttgctgatcatcgtgatcgccatcgtc
atcgcgatcattgcgctgctgctgccgcgcaccggccacgcggccgtgggcacccaggcc
gcgccggcaccgtcgcccgccaccgcgaccgccggcaagtgcccggccgccctcgatttc
cgcgtcaagcgcctgcaggacgatgcgccgcaagacctctgccagtacgccggccgcgtg
gtgctggtggtcaacaccgccagctattgcggctacacctaccagtacgaggggctcgaa
gcgctgtacgccaagtaccgcgacaagggcctgaccgtgctgggtttcccctccaatgac
ttcgagcaagagccgggcaccggcaagcagatcgccagcttctgctacaacacctacggg
gtgaagttcccgatgttctcgaagacgtcggtggtcgggccggcggcatcgccgctctac
cactggctgacccggcagaccgggcagccgcccaagtggaacttccacaagtatctgctg
gaccgcagcggccgcgtggtggcggtgtatccgagccggatcgagccgagtgatccggcc
atcgtcaaccgcatcgacaccctgctcgcggagccggcgccccgctga

DBGET integrated database retrieval system