KEGG   Ralstonia solanacearum CFBP2957: RCFBP_21349Help
Entry
RCFBP_21349       CDS       T01272                                 

Definition
secreted alkaline phosphatase lipoprotein (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rsc00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rsc00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rsc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3304815..3306266)
Genome map
AA seq 483 aa AA seqDB search
MHRLSLLSAAALAALALAACGSDGTSTGVAMPDAGTTVTGQTKNVVFFLGDGMGLTTMTA
ARIYKVGEDGELTMDTLPETGFVRTFSNNAQVTDSAPSMSAYMTGVKMNNEVISMSSDTA
AFDAGGKDYVSGADSTCPASGNGKPVATLLELMKAAGYGTGVVTTTRVTHATPAATYAHI
CHRDGENTIAAQLVPAGAGYNAALGDGVDVVFGGGRRHFQPSAAGGARTDGRDLVAELKA
AGYRYAGNKAEFDALSAGDGKVAGLFTGSHMAYDLDRDAAKEPSLAEMTTKAIDVLAARQ
KGFFLMVEGGRIDHALHETTARKALQDTVAFDAAIRGALDKLNTIDPGLKNTLVVVTADH
DHTLVLNGYAKRTGPSSDSNPGVLGLLKSYVNGATATDAGGNPYTILGFGTGENRPAART
ALTDAVVYDKTYHQEAVIPTAAGGETHGGTDVFIGARGLGAERFTGVIDNTEVFGLIKQA
VGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgactttcccttctgtccgccgccgcgctggccgcgctcgccctggcggcgtgc
ggcagcgacggcacttccaccggcgttgccatgccggacgccggtaccaccgtcacgggc
cagaccaagaacgtggtgttctttctcggcgacggcatgggcctgaccaccatgaccgcc
gcgcgcatctacaaggtgggcgaagacggcgagctgaccatggacacgctgcccgagacc
ggcttcgtgcggaccttctccaacaacgcgcaggtgaccgattccgcgccgtcgatgtcg
gcgtacatgaccggcgtgaagatgaacaacgaggtcatctccatgtcgtccgacacggcg
gcgttcgatgcgggcggcaaggattacgtgtccggcgccgacagcacctgcccggccagc
ggcaacggcaagccggtggcgacgctgctggagttgatgaaggccgcgggctacggcacg
ggcgtggtcaccaccacgcgcgtcacgcatgccacgccggcggccacctatgcgcacatc
tgccaccgcgatggcgagaacaccatcgccgcgcaactggtgccggccggcgcgggctac
aacgccgcgctgggcgatggcgtggacgtggtcttcggcggcggccgcaggcacttccag
ccgtctgccgcgggcggcgcgcgcaccgacggccgcgacctggtcgccgaactgaaggcg
gccggctaccggtacgccggcaacaaggccgagttcgatgcgctgtcggccggcgacggc
aaggtggcgggcctgttcaccggcagccacatggcctacgacctggaccgcgatgcggcc
aaggagccgagcctggccgagatgaccaccaaggccatcgacgtgctggccgccaggcag
aagggcttcttcctgatggtggaaggcggccgcatcgaccatgcgctgcacgagaccacg
gcgcgcaaggcgctgcaggacacggtggccttcgatgccgccatccgcggcgcgctggac
aagctcaacacgatcgacccgggcctgaagaacacgctcgtcgtcgtcaccgcggaccac
gaccacacgctggtgctcaacggctatgccaagcgcaccggccccagcagcgacagcaac
cccggcgtgctcggcctgctcaagagctacgtgaacggcgccaccgccaccgacgcgggc
ggcaacccgtacaccatcctgggcttcggcaccggcgagaaccgccccgccgcgcgcacc
gcgctcaccgacgcggtcgtctacgacaagacctaccaccaggaagccgtgatcccgacg
gcggccggcggcgagacgcacggcggcaccgatgtcttcatcggcgcgcgcggcctgggc
gccgagcgcttcacgggcgtgatcgacaacaccgaggtcttcggcctcatcaagcaggcc
gtcggcctgtaa

DBGET integrated database retrieval system