KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_069Help
Entry
TGRD_069          CDS       T00755                                 

Definition
(GenBank) mannonate dehydratase
  KO
K01686  
mannonate dehydratase [EC:4.2.1.8]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TGRD_069
Enzymes [BR:rsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.8  mannonate dehydratase
     TGRD_069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(122948..124042)
Genome map
AA seq 364 aa AA seqDB search
MKMTFRWYGENVDPIPLRYIRQIPGVEGIVWALHDIPAGECWTVERIEEVKAQAAKYNFN
TDVVESVNVHEDIKLGLPSRKKYIENYKNTLKNLGRAGVKVVCYNFMPVFDWTRTDLYKP
QSDGSTALFYEKAKVDNINPVKFLEQMSKQEGLLTMPGWEPERLSKIKELFEAYKEIKDD
DLWENLKYFLQEIIPVAQESGIKMAIHPDDPPWSIFGLSRIITCRDNIKKFLSLVDNPSN
GLTLCSGSLGSCTKNNIAAIVREFGDRIYFAHIRNIRHFKNGDFTETSHKTSDGSLDITE
IVKAYHDINYKYYVRPDHGRHIWDEKCRPGYGLYDRSLGIMYIFGLWDAFEKISASKRGQ
YGVE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaccttcaggtggtacggggaaaacgttgatcccataccgctgaggtatata
agacagatacccggcgttgaaggaatagtatgggcactgcatgacataccagcaggggaa
tgctggactgttgagcgcattgaagaagttaaggcgcaagctgcaaaatataactttaat
actgatgttgttgaaagtgttaatgttcacgaagatatcaaacttggacttccttcccgc
aaaaaatatatagaaaattataaaaatactcttaaaaatctcggcagagccggcgtaaaa
gtcgtatgttacaactttatgccggtttttgattggacacggacagacctgtacaaaccc
cagtctgacggttctacagcgcttttttatgaaaaagctaaagttgacaatataaatccg
gttaagtttttagaacaaatgtcaaaacaagaaggtcttttgacgatgcccggatgggag
ccggaaagactttcaaaaataaaagaactttttgaagcctataaagagataaaagatgac
gacctttgggaaaatctgaaatactttttgcaggaaattatacccgtcgcacaggaaagc
ggcataaaaatggccatacatcccgacgatccgccgtggagtatatttggtctttctcgt
ataataacctgcagagacaatatcaaaaaatttttaagccttgttgacaatccttcaaac
ggactcactttatgcagcggttctttaggctcctgcacgaaaaataacattgcagctata
gtgcgggagttcggcgacaggatatactttgcgcatatacgcaatatccggcattttaaa
aacggagattttacagagacttctcacaaaacttccgacggttctcttgatataacagaa
attgtaaaggcataccacgatataaattataaatattatgtccgtcctgatcatggacga
catatatgggacgaaaaatgccgacccggatatggtttatatgacagatctctcggcata
atgtacatttttggattatgggatgcttttgaaaaaatatctgcatctaaaagggggcag
tatggagtggaataa

DBGET integrated database retrieval system