KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_119Help
Entry
TGRD_119          CDS       T00755                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsd01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rsd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
177997..178773
Genome map
AA seq 258 aa AA seqDB search
MILDKIVAATKVRVEKAKLQKSFKTAKREALLNKKKNFVSFKKALSKAGINFICEVKKAS
PSKGLISTDFKYKEIALEYEKTGAAAISVLTEPNFFLGSIRYLQEIKSIVKIPVLRKDFI
IDSYQIYESRVIGADAVLLICAVLSYDVLKEFLETAQGLGMSCLVEAHNEEEIETALKAG
AEIIGVNNRNLRTFEVDFGNSMKLRRLVPVDKIFVSESGIKTKKHIDILKANDVNAVLIG
EELMKSGNIAERLRELKD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatattggataaaattgtcgcggcaacaaaagtaagagtggaaaaagcaaaacttcaa
aaatcttttaaaacagcgaaaagagaagccttattaaataaaaaaaagaattttgtttct
tttaaaaaagcattatcaaaagcgggaataaattttatctgcgaagttaaaaaggcatcg
ccgtcaaaaggattgatttcaactgactttaaatataaagaaattgctctggaatatgaa
aaaactggagccgccgcgatttccgttctcactgaaccgaatttttttcttggcagcata
aggtatttgcaggagataaaaagtattgttaaaatacctgttttgcgcaaagattttata
atagattcttaccaaatatatgaatcgagagtcatcggcgcggatgcagttcttttaata
tgtgctgttttatcatacgatgttttaaaggaatttttggagacggcgcagggactcggt
atgtcttgtcttgttgaagctcacaatgaggaagaaattgagacagcgttgaaagccggt
gcggagataataggcgtaaataacaggaatcttagaacttttgaagttgattttggcaac
agtatgaaactccgcagacttgtgccggtcgataaaatttttgtttcagaaagtggaatt
aaaacgaaaaaacatatagatattcttaaagcaaatgatgtcaatgcggttttgataggc
gaagaacttatgaaaagcggaaatattgcggaacgtcttagagaattgaaagactga

DBGET integrated database retrieval system