KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_179Help
Entry
TGRD_179          CDS       T00755                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TGRD_179
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TGRD_179
Enzymes [BR:rsd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TGRD_179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271892..273424
Genome map
AA seq 510 aa AA seqDB search
MKLRELLSDESAFVIGDEDTEVSGVSYDSRKIEKDYAFFSLPGHNTDGRKYIAEAIANGA
SVIITDSKYDTNDVAQVVIKDIFRFMSLFGAKFYNYPDRELNIMGITGTNGKTTVTYMIE
SILANSGIECGVIGTVNYRYKGKVIEANNTTPQSLDIYRIMRDISNNGIKYLVMEVSSHA
LSLGRVYGIEFDTAVFTNLTREHLDFHKNMDRYFEAKSALFKELGAGKKNNKKCAIINVD
DEYGRKLLKVGISAEIKLYSAIEKNAADFKASNIKVTNKGAVFNLVFCNKRARIRIKHIG
VHNVYNALAALAAAVCSEISFENAVEGLNNSSRVPGRLEKVNTIGLGFEIVVDYAHTDDA
LESVLRALKDLNPKRIIIVFGCGGDRDRAKRPLMGKIAVEMSDFVFVTSDNPRTEDPYQI
ILDIEVGIKRAGKKNYKVVVDREAAIKEVIMMAADKGDIILLAGKGHETYQITSGGKVHF
NDVKIAEKYIDLKKKQKIAAKQAGQREFIF
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagagaacttttgtctgatgaaagtgcgtttgttataggcgatgaggatacc
gaagtgtcaggagtgtcgtatgattcgagaaaaatagaaaaagattatgcctttttttcg
cttcctggtcataataccgatggcagaaagtatattgccgaagcaatagcaaatggagct
tccgtgattattactgattcaaaatacgatactaatgacgtggctcaagttgtcattaaa
gatatttttcgttttatgtcactttttggtgctaagttttataattatccagatagagaa
ttaaatattatgggtataaccggcacaaacggcaaaacgacggttacttatatgattgaa
agtatacttgcaaattcaggtatcgaatgtggagttataggcacggttaattatagatat
aaaggtaaagttattgaagcaaacaatacaacgccgcagtctttagatatttatagaatt
atgagagatatttcaaacaacggtattaaatatcttgtaatggaagtgtcttcacacgct
ttaagtttaggcagggtttacggaatagagtttgacacagccgtttttacaaatttaacg
cgtgagcatttggattttcataaaaatatggatagatattttgaggctaagtccgcactg
ttcaaagaacttggagcgggcaaaaaaaataataaaaagtgcgctataattaacgttgat
gatgaatacggcagaaaacttttaaaagtggggattagtgctgaaataaaactctattcc
gcgatagaaaaaaatgcggcggactttaaagccagcaatattaaggttacaaataaagga
gctgtgtttaacttggttttttgtaacaaaagggcaagaattagaataaaacatataggt
gtgcacaacgtttacaatgctttagcggctttggctgccgccgtttgcagcgaaatctct
tttgagaatgccgttgaaggattaaataattccagccgggtgcccggcagacttgaaaaa
gttaatacgataggactggggtttgagatagtcgttgattatgcgcatactgatgatgct
ttagaaagtgttttacgagctttgaaagatctaaatccgaaaagaattataatcgttttt
ggttgcggtggtgatagagacagagcgaagagacctttgatgggaaaaattgctgttgaa
atgagtgattttgtttttgtaacatctgacaatccgagaacagaagatccgtatcagata
attttagatatagaagtcggaataaagagagcgggcaaaaaaaattataaagttgtagtt
gacagagaagcggcaataaaagaagttattatgatggcagcagataaaggcgatattatt
ctgcttgccggaaaagggcacgagacttatcagattacgagtggtggaaaagttcatttc
aatgatgttaaaattgctgaaaagtatattgatttaaaaaagaagcaaaaaattgcggca
aaacaagcgggacagagggagtttatcttttag

DBGET integrated database retrieval system