KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_196Help
Entry
TGRD_196          CDS       T00755                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rsd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296932..297456
Genome map
AA seq 174 aa AA seqDB search
MKNAVYLSLGSNVGDRAENIVSALSFLQSSLFADIKKISSFYETAPIGPKQRSFYNIVIE
AQTDLKPDDLLLFIKQAEHILGRRKTIRWGPRVIDIDILLFCRKIINQTGLTVPHKEIQN
RLFVLIPLSEIAGDFVHPVLKQKISGILYDKSLTLKCQKVKIIQTNIANRSLKN
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgctgtatatttaagtttagggtcaaacgtcggcgacagagcggaaaatatt
gtttccgctttatcttttttgcaaagcagtttatttgcagatattaaaaagatttcttct
ttttatgaaacggcgccgattggtcctaaacaaagaagtttttataatattgtaattgaa
gcgcagacagatttaaaaccggatgatttgcttttatttataaaacaggctgaacatatt
ttagggcggaggaagacgataagatgggggccgcgcgttattgatattgacattctgctt
ttttgcagaaaaattattaatcaaaccggtttaactgtgccgcataaagagatacagaac
agactttttgttttaattccgttaagcgaaatagctggcgactttgtacaccctgtttta
aaacagaaaatcagcggtattttatacgataaatcattgacacttaaatgccaaaaggtt
aaaatcatacaaacaaatattgcaaatcggagtttgaaaaattga

DBGET integrated database retrieval system