KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_207Help
Entry
TGRD_207          CDS       T00755                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rsd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313764..314336
Genome map
AA seq 190 aa AA seqDB search
MQIFNFDEKKAQRAVKLLLESFGEDLNREGIKRTPERVAEFYKEVLSGNKIDPLKFIPVH
YATEDHEEIVLVKDITFYSLCEHHLLPFFGKMHIAYIPKKDRIIGVSKLIKLVEIFANRL
QLQERLTKQLADIVMKFVKPHGVMVVVEAEHLCMTMRGVKKTGSKIITSAMRGIFLKDVR
TRSEAMSLLR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaatatttaattttgatgaaaaaaaggcacaaagagccgtaaaacttttacttgaa
tcttttggtgaagatttaaacagagaaggtataaaacgtacgcctgaaagagttgcggag
ttttataaggaagtattatctggaaataaaattgatcctttaaaatttattccagtgcat
tatgcgacagaagaccatgaggagatagttttagttaaagatattactttttattctctg
tgcgaacatcatttgctcccttttttcggtaaaatgcacatagcgtatatacctaaaaaa
gacaggataatcggagtatcaaaacttataaaacttgttgaaatttttgcaaatagactc
cagcttcaggaaagacttacaaaacagcttgcagatatagtaatgaagtttgtaaagccg
catggagttatggtagttgttgaagcagaacatttgtgtatgacgatgagaggcgtaaaa
aaaacaggttcaaaaataattacttccgccatgcgtggcatatttttgaaagacgtaaga
acacgctcagaagcgatgtctctattaagatga

DBGET integrated database retrieval system