KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_207Help
Entry
TGRD_207          CDS       T00755                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TGRD_207
Enzymes [BR:rsd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TGRD_207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313764..314336
Genome map
AA seq 190 aa AA seqDB search
MQIFNFDEKKAQRAVKLLLESFGEDLNREGIKRTPERVAEFYKEVLSGNKIDPLKFIPVH
YATEDHEEIVLVKDITFYSLCEHHLLPFFGKMHIAYIPKKDRIIGVSKLIKLVEIFANRL
QLQERLTKQLADIVMKFVKPHGVMVVVEAEHLCMTMRGVKKTGSKIITSAMRGIFLKDVR
TRSEAMSLLR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaatatttaattttgatgaaaaaaaggcacaaagagccgtaaaacttttacttgaa
tcttttggtgaagatttaaacagagaaggtataaaacgtacgcctgaaagagttgcggag
ttttataaggaagtattatctggaaataaaattgatcctttaaaatttattccagtgcat
tatgcgacagaagaccatgaggagatagttttagttaaagatattactttttattctctg
tgcgaacatcatttgctcccttttttcggtaaaatgcacatagcgtatatacctaaaaaa
gacaggataatcggagtatcaaaacttataaaacttgttgaaatttttgcaaatagactc
cagcttcaggaaagacttacaaaacagcttgcagatatagtaatgaagtttgtaaagccg
catggagttatggtagttgttgaagcagaacatttgtgtatgacgatgagaggcgtaaaa
aaaacaggttcaaaaataattacttccgccatgcgtggcatatttttgaaagacgtaaga
acacgctcagaagcgatgtctctattaagatga

DBGET integrated database retrieval system