KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_208Help
Entry
TGRD_208          CDS       T00755                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TGRD_208
Enzymes [BR:rsd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TGRD_208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
314748..315914
Genome map
AA seq 388 aa AA seqDB search
MIIRKAIVSNFNDALRLVKNTGSSSIVNELLAKKGVFNAIVIEKIDNRAANILKQETISV
GASVALNENVSRFKKGISNTVLFATVNQIEKLIKKLRLQPFRLKEIALKLENIVNKKKVF
KYRERYMDLSNPVVMGIVNVDPNSFSGDGLTDPNEALKQAVEFERFGAGIIDIGAESSRP
GTKLIDAKTEIKRLIPALKRIRKNVKIPVSVDTYKYETVKAALDEGADIINDIFALRKGR
ERSAKLIADAKAGVILMHMKGIPKNMQTSPEYKNCTSEVYGFLAQQKEYAVGFDIEEERI
AVDPGPGFGKTVEHSVELIKNIGVFSTLGAVVGAVSRKRFIKALAGEDRTSFIAANFLAG
FCGADIIRAHDVKETVNVLKMAETFRRM
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgattataagaaaagcaattgttagtaactttaatgacgctttaagacttgtaaaaaac
accgggagcagcagcattgttaacgaacttcttgcaaaaaaaggagttttcaatgcgata
gttattgaaaaaatagataatagagcagcaaatattttaaaacaggaaactatttctgtc
ggagcttctgttgcattaaacgaaaatgtcagtagatttaaaaaaggcatatccaataca
gttttatttgctaccgtaaatcaaattgagaagttgataaagaagcttcgcttacaaccg
tttagattgaaagaaattgctttaaaacttgaaaatatagtaaacaaaaaaaaagttttc
aaatatagagaaagatatatggatttgtcaaatccggttgttatgggtattgtaaatgta
gatcccaattctttttccggcgacggacttacagatcctaatgaagcgcttaaacaggcg
gttgaatttgaaaggtttggtgcgggaataatagatataggcgccgaatcttcaagaccg
ggaacaaaacttattgatgcaaaaacagaaataaagaggctaattcctgctcttaaaaga
ataaggaaaaatgttaagattcccgtttcggtagatacttataagtatgagactgtgaaa
gcagctcttgatgaaggcgcggatataataaatgatatttttgctttaaggaaaggtaga
gaaagatcagcaaagcttattgcggatgcgaaagccggagtgatacttatgcatatgaaa
ggcatacctaaaaatatgcagacatctccggaatataaaaactgtacatcggaagtttac
ggatttcttgcgcagcaaaaagaatatgcagttggttttgatatagaagaggaacgtatt
gcagttgaccctggtccaggttttggaaaaacagtagaacatagtgttgagttaataaag
aatattggcgttttctcaacgcttggtgctgttgtgggagcggtgtcaagaaaaagattt
ataaaagcgcttgcaggtgaagatagaacgtcgtttattgctgcaaattttcttgcgggg
ttttgtggcgcagatattataagagcacacgatgtaaaagagacagtaaacgttttgaaa
atggctgagacttttcggagaatgtaa

DBGET integrated database retrieval system