KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_277Help
Entry
TGRD_277          CDS       T00755                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TGRD_277
DNA repair and recombination proteins [BR:rsd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TGRD_277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
418613..419209
Genome map
AA seq 198 aa AA seqDB search
MNRPRPVEKMVGIIKKLPGVGHKMAERLSYHILKMPQVEVDRLIDSIQNARRTMKCCSIC
CNLSEHDPCPICSDVTREKNIVCVVETPQDLIAVSKVEDYKGLYFVLGGALSPLDAVGPD
DIRIDKLIKRLKRDSINEVIIATDADSKGEITAVYLADIIKILGIKVTRLGYGLPVGGDI
EYADEITISRAIAGRKEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaccgcggcccgtagagaaaatggttggaataataaaaaaactaccaggtgta
ggacataaaatggcggaacgtctgagctatcatatattgaaaatgcctcaagtggaagtt
gacagacttatagattctatacaaaatgcgagacgaacgatgaagtgttgcagcatctgc
tgcaatttaagcgaacacgatccatgtcctatatgttctgatgttacaagagaaaagaat
attgtatgcgttgtggaaactcctcaggatttaatagccgtcagcaaagttgaagattat
aaagggctttattttgtgcttggaggtgctttatcgcctcttgatgcggtaggtcctgat
gacataagaattgataagttgataaagagattgaaaagagatagcattaacgaagtaata
attgctactgatgcagactctaagggcgaaataactgctgtttaccttgcagatattatt
aaaatattaggcattaaggtcacaagattaggttatggtttacctgtcggcggtgatatt
gagtatgccgatgagataactatctcgcgtgctattgcaggacggaaagaaatgtaa

DBGET integrated database retrieval system