KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_279Help
Entry
TGRD_279          CDS       T00755                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
rsd00010  Glycolysis / Gluconeogenesis
rsd00020  Citrate cycle (TCA cycle)
rsd00620  Pyruvate metabolism
rsd00640  Propanoate metabolism
rsd00650  Butanoate metabolism
rsd00680  Methane metabolism
rsd01100  Metabolic pathways
rsd01120  Microbial metabolism in diverse environments
rsd01130  Biosynthesis of antibiotics
rsd01200  Carbon metabolism
Module
rsd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGRD_279
   00020 Citrate cycle (TCA cycle)
    TGRD_279
   00620 Pyruvate metabolism
    TGRD_279
   00640 Propanoate metabolism
    TGRD_279
   00650 Butanoate metabolism
    TGRD_279
  Energy metabolism
   00680 Methane metabolism
    TGRD_279
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TGRD_279
Enzymes [BR:rsd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TGRD_279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_10 Fer4_7 Fer4_6 Fer4_2 Fer4_9 Fer4_4 Fer4_13 Fer4_17 Fer4_16 Fer4_8 Fer4_15 ETF_QO Fer4_22
Motif
Other DBs
NCBI-ProteinID: BAG13762
UniProt: B1GZT0
Position
419992..420303
Genome map
AA seq 103 aa AA seqDB search
MKKEERKLTAVEIPIGDIVEAETAVEFNTGSWRSERPVWNKEKCIHCLTCWISCPDSSVK
IASDEKRITIVTGIDYDHCKGCGICARECPPKIKAITMEHEKK
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagaagaaagaaaattaactgctgttgaaatacctataggcgatatagttgaa
gctgaaacggcagtcgaatttaatacgggaagctggcgttctgaaagacccgtatggaat
aaagaaaaatgcattcattgtttaacatgttggatttcatgccctgattcttctgtaaag
attgcttcagatgaaaagagaataacgattgttacaggtatagattatgaccattgcaaa
ggttgcggaatttgtgcaagagaatgtccgcctaaaattaaagcaattacaatggaacat
gaaaagaaataa

DBGET integrated database retrieval system