KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_280Help
Entry
TGRD_280          CDS       T00755                                 

Definition
pyruvate:ferredoxin oxidoreductase alpha subunit
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:rsd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsd00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rsd00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rsd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rsd00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rsd00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:rsd00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420338..421543
Genome map
AA seq 401 aa AA seqDB search
MIKTVYSKGKLVAKTGNEVVAEAMRQIEPDVVAAYPITPATEIVQIFSQFVADGIVKSEY
VAVESEHSAMSATIGASAAGARAMTGTSSQGLSLMWEMLYIASGLRLPIVMAEVNRAISA
PINIHGDQSDTMGARDAGWIQIYSENSQEAYDNMIQATRIAEKAKLPTLVTTDGFIISHC
MEVVETYPDADVKAFIGKYEPERYLLDIKKPYTLGSIDLQDYYFEHRYQLAQAMRNAKNI
VLDVAKDFEKTFGRKYDLCEKYMLDDAEIAIAVIGSTAGTAKVVVNELREKGIKAGLLKI
RVYRPFPAEEIAKDLAHVKAVAVMDRADSCSGAFAPVYSDIVASLYASGVTNPKVVNYVY
GLGGREINTGHIIGIYEMLCKIASGTEKSSNKVEYINVRIK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgataaagacagtatactcaaaaggtaaacttgttgcaaagaccggcaacgaagttgta
gctgaagcaatgcgccagatagagccggatgtagtagcggcatatcctataactccggca
actgaaatcgtacagattttctcacagtttgttgcagacggtattgtaaaaagcgagtat
gtcgcggtagaaagcgaacattcggcgatgtcggctacgataggggcatcggcagccggc
gcaagagcaatgacaggcacttcttcacagggattatctcttatgtgggaaatgctttat
atagcttcaggacttaggcttcctatagttatggcggaagtcaacagggcaatttctgct
ccgattaacattcacggagatcagtcggatacaatgggcgcaagagatgcgggatggatt
cagatatattcggaaaactcgcaggaagcttacgataatatgattcaggctacaagaata
gccgaaaaagcaaaacttcctacgcttgtgacgacagatgggtttattatttctcattgt
atggaagttgtcgagacttatcctgatgcagatgtaaaagcttttataggtaaatacgaa
cctgaaagatatcttttagatattaagaagccttatacgctaggttcaattgatttacaa
gattactattttgaacacagataccagcttgcgcaggctatgagaaatgcgaaaaatata
gttttagatgttgcgaaagattttgaaaaaacttttggacgcaaatacgatttatgtgag
aaatatatgcttgacgatgcagaaattgcaatagcggttataggttcaacagccggaact
gcaaaagtcgtagtaaatgaattgagagaaaagggtattaaggcgggtcttttaaagata
agagtttacagaccgttcccagcggaagaaattgcaaaagatttagcgcatgttaaagca
gttgcggttatggacagagcggattcatgttccggtgcatttgctcctgtttattcggat
attgtcgcatctttgtatgcctcgggagttacaaaccctaaagttgtgaactatgtttac
ggtcttggcggaagagaaatcaataccggacatattatcggtatttacgagatgctttgc
aaaattgcttcaggtacagaaaaatcgtcaaataaagttgaatatataaatgtaagaata
aaataa

DBGET integrated database retrieval system