KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_281Help
Entry
TGRD_281          CDS       T00755                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
rsd00010  Glycolysis / Gluconeogenesis
rsd00020  Citrate cycle (TCA cycle)
rsd00620  Pyruvate metabolism
rsd00640  Propanoate metabolism
rsd00650  Butanoate metabolism
rsd00680  Methane metabolism
rsd01100  Metabolic pathways
rsd01120  Microbial metabolism in diverse environments
rsd01130  Biosynthesis of antibiotics
rsd01200  Carbon metabolism
Module
rsd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGRD_281
   00020 Citrate cycle (TCA cycle)
    TGRD_281
   00620 Pyruvate metabolism
    TGRD_281
   00640 Propanoate metabolism
    TGRD_281
   00650 Butanoate metabolism
    TGRD_281
  Energy metabolism
   00680 Methane metabolism
    TGRD_281
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TGRD_281
Enzymes [BR:rsd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TGRD_281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DUF2630
Motif
Other DBs
NCBI-ProteinID: BAG13764
UniProt: B1GZT2
Position
421737..422672
Genome map
AA seq 311 aa AA seqDB search
MANLKELSKNPERLTGGHRLCAGCGAGIVARQTLIAAGSTPVVITNATGCLEVSTTVFPY
TAWKDSFFHSAFENSAATCSGIETAYRSLKAQGKIKDDIRFITFGGDGGTYDIGLQSLSG
AMERGHRMLYICYNNEAYMNTGIQRSGATPKGAHTTTAPAGKVRQGKEQNKKDLTQIMIA
HDIPYVAQAYVGNWNDFITKVQKALAVDGPSFINILTPCRLGWAYKPEDTMLISRLAVET
CVWPSFEVENGVYKINVIPKEKKPVIEFLKLQGRFKHLFRSDNAHILETIQKGVDEKWDL
LQRRSAVGCRA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatttgaaagaattaagcaaaaacccagagcggttgacaggcggacaccgtctt
tgcgctggctgcggtgcaggtatagttgcgaggcagactttaatagccgccggtagcacg
ccggttgttattacaaacgctacagggtgtttggaagtttcgacgacggttttcccttat
acggcatggaaagattctttttttcacagtgcttttgaaaattcggcggcaacatgcagc
ggcattgaaactgcatatagaagtttaaaagcacaggggaaaattaaagacgatataagg
tttataacttttggtggtgatggtggaacttatgacataggtttacagtctttgtcgggt
gcaatggagagagggcacagaatgctttatatatgttataacaatgaagcatatatgaac
accggaatccaaagatctggggcaactcctaaaggagctcatacgacaactgctcctgcg
gggaaagtgcggcagggtaaagaacaaaataaaaaagatttaacgcagataatgattgct
cacgatattccttatgttgcgcaggcttatgttggaaactggaatgattttataacaaaa
gttcagaaagctttggcagttgacggaccgtcatttataaatattttaacgccttgcaga
ctgggctgggcatataaaccggaagatacgatgttgatttcaagacttgcggttgaaacc
tgtgtttggccttcttttgaggttgaaaatggcgtttataaaataaatgttatacctaag
gaaaagaagcctgtaatagaattcttaaaacttcagggaaggtttaaacatcttttcaga
tccgataacgctcatattcttgagacaattcagaaaggcgttgacgaaaaatgggatctt
ttacaacgtaggtcagccgtcggttgtcgagcataa

DBGET integrated database retrieval system