KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_308Help
Entry
TGRD_308          CDS       T00755                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:rsd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsd00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rsd00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rsd00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:rsd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462003..462965
Genome map
AA seq 320 aa AA seqDB search
MAKRVGIITSGGDAPGMNAAIRAVARRGIFWGYQMIGIKRGFKGLLDYEFMTLTLRSVSG
IINTGGTVLHTGRCPEMKTKIGMGRAVKAIKDLGLSAVIIIGGDGSLAAGNSLSKHGIKV
INIAASIDNDIYGTDETIGYDTALNTAVEAIDKIRDTAKSHDRVFVVEIMGREHGFLTVD
VGLAAGCEYIVVPEMKVDMQKLTAELKKGKERGKTSEIIAFAEGCGCSAEFAKKVEKLTG
LDVRVSNLGYIQRGGRPTARTRILASKFGHAAMDLFHKGKANLFVGITNGNVSAVSICEA
IKCEKKFDVKTAKIVKNLSV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagagtaggtattataacttcaggtggggatgccccgggaatgaatgcggct
atcagagccgtcgcaagacgcgggattttttggggataccagatgataggtataaaaaga
ggatttaaaggacttcttgactatgaatttatgacgcttactttgcgatcggtaagcggt
ataataaatactggcggaacagtgttacacacgggaagatgtcctgaaatgaaaacaaaa
atcggaatgggcagagctgttaaggctataaaagaccttggattgagtgctgtgataatt
ataggaggagacggttctctggctgctggtaattccttgtcaaaacacggaataaaggtt
ataaatattgcagcatctattgataacgacatatacggcacagatgaaactataggttat
gacacggctttaaatactgctgtagaagctatagacaaaataagggatactgcaaaaagc
cacgacagggtttttgtagttgaaattatgggcagggaacacggatttttaactgttgac
gtcggacttgcagcgggttgcgaatatatagtggtaccggaaatgaaagttgatatgcaa
aaacttactgcagaactcaagaaaggaaaagaaagaggaaaaacttctgaaattatagct
tttgccgaaggatgtggttgttcagctgagtttgcaaaaaaagtggaaaaacttactggt
cttgacgtaagagtaagcaatctcggatatatacagcgtggcggaagaccgactgccagg
acaaggatacttgcttcaaaattcggacatgccgcgatggatcttttccataaaggaaaa
gcgaatctttttgtaggaataactaacggcaatgtatctgcagtatcgatttgtgaggct
ataaaatgtgaaaagaaatttgatgtaaagaccgctaaaatagtgaaaaatttgtcagtt
taa

DBGET integrated database retrieval system