KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_308Help
Entry
TGRD_308          CDS       T00755                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
rsd00010  Glycolysis / Gluconeogenesis
rsd00030  Pentose phosphate pathway
rsd00051  Fructose and mannose metabolism
rsd00680  Methane metabolism
rsd01100  Metabolic pathways
rsd01110  Biosynthesis of secondary metabolites
rsd01120  Microbial metabolism in diverse environments
rsd01130  Biosynthesis of antibiotics
rsd01200  Carbon metabolism
rsd01230  Biosynthesis of amino acids
rsd03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGRD_308
   00030 Pentose phosphate pathway
    TGRD_308
   00051 Fructose and mannose metabolism
    TGRD_308
   00052 Galactose metabolism
    TGRD_308
  Energy metabolism
   00680 Methane metabolism
    TGRD_308
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TGRD_308
Enzymes [BR:rsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TGRD_308
Protein phosphatases and associated proteins [BR:rsd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TGRD_308
Messenger RNA biogenesis [BR:rsd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TGRD_308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK AP_endonuc_2 Dimer_Tnp_Tn5
Motif
Other DBs
NCBI-ProteinID: BAG13791
UniProt: B1GZV9
Position
462003..462965
Genome map
AA seq 320 aa AA seqDB search
MAKRVGIITSGGDAPGMNAAIRAVARRGIFWGYQMIGIKRGFKGLLDYEFMTLTLRSVSG
IINTGGTVLHTGRCPEMKTKIGMGRAVKAIKDLGLSAVIIIGGDGSLAAGNSLSKHGIKV
INIAASIDNDIYGTDETIGYDTALNTAVEAIDKIRDTAKSHDRVFVVEIMGREHGFLTVD
VGLAAGCEYIVVPEMKVDMQKLTAELKKGKERGKTSEIIAFAEGCGCSAEFAKKVEKLTG
LDVRVSNLGYIQRGGRPTARTRILASKFGHAAMDLFHKGKANLFVGITNGNVSAVSICEA
IKCEKKFDVKTAKIVKNLSV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagagtaggtattataacttcaggtggggatgccccgggaatgaatgcggct
atcagagccgtcgcaagacgcgggattttttggggataccagatgataggtataaaaaga
ggatttaaaggacttcttgactatgaatttatgacgcttactttgcgatcggtaagcggt
ataataaatactggcggaacagtgttacacacgggaagatgtcctgaaatgaaaacaaaa
atcggaatgggcagagctgttaaggctataaaagaccttggattgagtgctgtgataatt
ataggaggagacggttctctggctgctggtaattccttgtcaaaacacggaataaaggtt
ataaatattgcagcatctattgataacgacatatacggcacagatgaaactataggttat
gacacggctttaaatactgctgtagaagctatagacaaaataagggatactgcaaaaagc
cacgacagggtttttgtagttgaaattatgggcagggaacacggatttttaactgttgac
gtcggacttgcagcgggttgcgaatatatagtggtaccggaaatgaaagttgatatgcaa
aaacttactgcagaactcaagaaaggaaaagaaagaggaaaaacttctgaaattatagct
tttgccgaaggatgtggttgttcagctgagtttgcaaaaaaagtggaaaaacttactggt
cttgacgtaagagtaagcaatctcggatatatacagcgtggcggaagaccgactgccagg
acaaggatacttgcttcaaaattcggacatgccgcgatggatcttttccataaaggaaaa
gcgaatctttttgtaggaataactaacggcaatgtatctgcagtatcgatttgtgaggct
ataaaatgtgaaaagaaatttgatgtaaagaccgctaaaatagtgaaaaatttgtcagtt
taa

DBGET integrated database retrieval system