KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_308Help
Entry
TGRD_308          CDS       T00755                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGRD_308
   01230 Biosynthesis of amino acids
    TGRD_308
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGRD_308
   00030 Pentose phosphate pathway
    TGRD_308
   00051 Fructose and mannose metabolism
    TGRD_308
   00052 Galactose metabolism
    TGRD_308
  Energy metabolism
   00680 Methane metabolism
    TGRD_308
Enzymes [BR:rsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TGRD_308
Protein phosphatases and associated proteins [BR:rsd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TGRD_308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462003..462965
Genome map
AA seq 320 aa AA seqDB search
MAKRVGIITSGGDAPGMNAAIRAVARRGIFWGYQMIGIKRGFKGLLDYEFMTLTLRSVSG
IINTGGTVLHTGRCPEMKTKIGMGRAVKAIKDLGLSAVIIIGGDGSLAAGNSLSKHGIKV
INIAASIDNDIYGTDETIGYDTALNTAVEAIDKIRDTAKSHDRVFVVEIMGREHGFLTVD
VGLAAGCEYIVVPEMKVDMQKLTAELKKGKERGKTSEIIAFAEGCGCSAEFAKKVEKLTG
LDVRVSNLGYIQRGGRPTARTRILASKFGHAAMDLFHKGKANLFVGITNGNVSAVSICEA
IKCEKKFDVKTAKIVKNLSV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagagtaggtattataacttcaggtggggatgccccgggaatgaatgcggct
atcagagccgtcgcaagacgcgggattttttggggataccagatgataggtataaaaaga
ggatttaaaggacttcttgactatgaatttatgacgcttactttgcgatcggtaagcggt
ataataaatactggcggaacagtgttacacacgggaagatgtcctgaaatgaaaacaaaa
atcggaatgggcagagctgttaaggctataaaagaccttggattgagtgctgtgataatt
ataggaggagacggttctctggctgctggtaattccttgtcaaaacacggaataaaggtt
ataaatattgcagcatctattgataacgacatatacggcacagatgaaactataggttat
gacacggctttaaatactgctgtagaagctatagacaaaataagggatactgcaaaaagc
cacgacagggtttttgtagttgaaattatgggcagggaacacggatttttaactgttgac
gtcggacttgcagcgggttgcgaatatatagtggtaccggaaatgaaagttgatatgcaa
aaacttactgcagaactcaagaaaggaaaagaaagaggaaaaacttctgaaattatagct
tttgccgaaggatgtggttgttcagctgagtttgcaaaaaaagtggaaaaacttactggt
cttgacgtaagagtaagcaatctcggatatatacagcgtggcggaagaccgactgccagg
acaaggatacttgcttcaaaattcggacatgccgcgatggatcttttccataaaggaaaa
gcgaatctttttgtaggaataactaacggcaatgtatctgcagtatcgatttgtgaggct
ataaaatgtgaaaagaaatttgatgtaaagaccgctaaaatagtgaaaaatttgtcagtt
taa

DBGET integrated database retrieval system