KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_312Help
Entry
TGRD_312          CDS       T00755                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
rsd00010  Glycolysis / Gluconeogenesis
rsd00051  Fructose and mannose metabolism
rsd00562  Inositol phosphate metabolism
rsd01100  Metabolic pathways
rsd01110  Biosynthesis of secondary metabolites
rsd01120  Microbial metabolism in diverse environments
rsd01130  Biosynthesis of antibiotics
rsd01200  Carbon metabolism
rsd01230  Biosynthesis of amino acids
Module
rsd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGRD_312
   00051 Fructose and mannose metabolism
    TGRD_312
   00562 Inositol phosphate metabolism
    TGRD_312
Enzymes [BR:rsd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TGRD_312
Exosome [BR:rsd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TGRD_312
  Exosomal proteins of bladder cancer cells
   TGRD_312
  Exosomal proteins of melanoma cells
   TGRD_312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: BAG13795
UniProt: B1GZW3
Position
468968..469720
Genome map
AA seq 250 aa AA seqDB search
MRKPLMAGNWKMNKTVSEAVSFVKALKGAVTGVSNVEILVCPAFTVLYEVNNEIKGSNIN
LGAQNLFGEAKGAFTGEISTAMIRDTGCSYVIVGHSERRQYFGETDEAVNKKTKAALAAD
ITPIVCVGETLKERENNVTFSVIEKQVRNGLADLTLQQASLTVIAYEPVWAIGTGKTATP
DQAQEVHSFIRKIYAQMYEESAEKVRILYGGSVNPGNVSDLMKKSDIDGGLVGGASLEAE
SFTKLVKYSK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacccttgatggcaggaaattggaagatgaataaaactgtttcagaggctgtg
agttttgtaaaagcacttaaaggcgcggttactggcgtatcaaatgttgagattttggtt
tgccctgcctttacggtgctttatgaggtgaataatgaaattaaaggttcaaatattaat
ttaggagcgcagaatctttttggggaggcaaaaggagcatttaccggtgagatttctaca
gcgatgataagagataccggatgctcttacgttatagtaggtcattctgagcgcagacaa
tatttcggcgagactgatgaagctgtaaacaaaaaaacaaaagcagcacttgcagcggat
attactcccatagtttgtgtaggcgaaactcttaaagaaagagaaaataatgtaactttt
agtgttatagaaaaacaggtgcggaacggcttggcggatcttactttgcagcaggcgtct
ttaacggttatagcttatgaacccgtatgggctataggaacgggaaagactgcaactccc
gatcaggctcaggaagtccactcttttataagaaaaatatatgcgcagatgtatgaggaa
tctgccgagaaagtaagaattctttacggcggttccgtaaatccgggcaatgtatcggat
cttatgaaaaaatccgatattgatggcggtttagtaggcggagcaagtttagaagccgaa
tcttttacaaaacttgtcaaatattctaagtaa

DBGET integrated database retrieval system