KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_340Help
Entry
TGRD_340          CDS       T00755                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGRD_340
   01230 Biosynthesis of amino acids
    TGRD_340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGRD_340
  Energy metabolism
   00680 Methane metabolism
    TGRD_340
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TGRD_340
Enzymes [BR:rsd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TGRD_340
Exosome [BR:rsd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TGRD_340
  Exosomal proteins of melanoma cells
   TGRD_340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513423..514172
Genome map
AA seq 249 aa AA seqDB search
MYKVVLIRHGESVWNKENKFTGWSDVDLSEKGNEEALKAGKQLKKDGFTFDLAYTSVLKR
AIKTLWNVLNTMDLLWTPVVKDWRLNERHYGALQGLNKAETAAKYGEEQVKIWRRSYDIA
PMALDENDERYPGKEARYSGLLKGEIPLAECLKDTVARVVPYWGKEVVPQIKAGKKIIIA
AHGNSLRALVKYLDNISDSNIVNLNIPTAMPLVYELDENLKAVKNYYLGDPEAVKKAMET
VASQGKVKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagttgttttaatcaggcacggcgaaagcgtctggaacaaggaaaataaattt
acgggctggtcagatgttgatttatccgaaaaaggcaatgaagaagctttaaaagccggg
aaacagttgaaaaaagacggttttacttttgatttggcatatacttcagttcttaaaagg
gcgattaaaactctttggaatgtgcttaatacaatggatttgctatggacccctgtggtt
aaggattggagattaaatgaaaggcattatggtgctttacaggggttaaacaaagccgag
acagccgcaaaatacggtgaagaacaggtaaaaatctggagaagaagttacgatattgcg
ccgatggctttagatgaaaatgacgaaagatatccggggaaagaggcaagatattcaggg
cttttaaaaggcgagattcccttagcggaatgtttaaaagatactgtggcaagagttgtt
ccctattggggaaaagaggttgttccgcagataaaagcaggcaaaaaaatcattatagcg
gcgcacggcaacagtttaagagctttggtgaagtatcttgataatataagtgacagcaat
atagtgaatttgaatatacctaccgcaatgccgcttgtttatgaacttgatgaaaattta
aaagctgttaagaattactatttaggcgatcccgaagctgttaaaaaagcgatggaaacg
gtagcaagtcagggtaaagttaaaaagtaa

DBGET integrated database retrieval system