KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_340Help
Entry
TGRD_340          CDS       T00755                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:rsd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsd00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:rsd00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rsd00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513423..514172
Genome map
AA seq 249 aa AA seqDB search
MYKVVLIRHGESVWNKENKFTGWSDVDLSEKGNEEALKAGKQLKKDGFTFDLAYTSVLKR
AIKTLWNVLNTMDLLWTPVVKDWRLNERHYGALQGLNKAETAAKYGEEQVKIWRRSYDIA
PMALDENDERYPGKEARYSGLLKGEIPLAECLKDTVARVVPYWGKEVVPQIKAGKKIIIA
AHGNSLRALVKYLDNISDSNIVNLNIPTAMPLVYELDENLKAVKNYYLGDPEAVKKAMET
VASQGKVKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagttgttttaatcaggcacggcgaaagcgtctggaacaaggaaaataaattt
acgggctggtcagatgttgatttatccgaaaaaggcaatgaagaagctttaaaagccggg
aaacagttgaaaaaagacggttttacttttgatttggcatatacttcagttcttaaaagg
gcgattaaaactctttggaatgtgcttaatacaatggatttgctatggacccctgtggtt
aaggattggagattaaatgaaaggcattatggtgctttacaggggttaaacaaagccgag
acagccgcaaaatacggtgaagaacaggtaaaaatctggagaagaagttacgatattgcg
ccgatggctttagatgaaaatgacgaaagatatccggggaaagaggcaagatattcaggg
cttttaaaaggcgagattcccttagcggaatgtttaaaagatactgtggcaagagttgtt
ccctattggggaaaagaggttgttccgcagataaaagcaggcaaaaaaatcattatagcg
gcgcacggcaacagtttaagagctttggtgaagtatcttgataatataagtgacagcaat
atagtgaatttgaatatacctaccgcaatgccgcttgtttatgaacttgatgaaaattta
aaagctgttaagaattactatttaggcgatcccgaagctgttaaaaaagcgatggaaacg
gtagcaagtcagggtaaagttaaaaagtaa

DBGET integrated database retrieval system