KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_460Help
Entry
TGRD_460          CDS       T00755                                 

Definition
Holliday junction resolvasome DNA-binding subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TGRD_460
Enzymes [BR:rsd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TGRD_460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(669306..669920)
Genome map
AA seq 204 aa AA seqDB search
MIDYLYGTLDSKSTDGITIDVNGIGYEISVPISTFLKLPETRNPIKIYIVESTAGMYGGV
ISLYGFFTIEEREMYLLIKDKVHGIGAKKAMEYTDKISKSFANFKTAIISKNPSMLNEIF
GFTKKTADKLIVALKDKISTVNVLNKEKQTGAETIKNTMVSEAIAGLITLGYKMQQARVA
VTNVYEHNENITLEDLIKKSLQYL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatagattacttatatggaacccttgattcaaaatcaacagatggcataaccatcgat
gttaacggcatcggttatgaaatatcagtcccgatttcaacttttttaaaacttcctgaa
actagaaatccgataaaaatatatatagttgaatctaccgcgggaatgtatggcggagtt
atctctttgtacggtttttttacaatagaagaaagagagatgtatcttctcataaaagat
aaagttcatggaatcggtgccaaaaaagctatggaatataccgacaaaatttccaaatct
tttgcgaatttcaaaactgcgataatttcaaaaaatccgtcaatgctaaatgaaatattt
ggttttacaaaaaaaaccgcggacaaacttattgtcgctttaaaagacaaaatatccaca
gtaaatgttttaaacaaagaaaaacagacaggtgcagagacaattaaaaatactatggtt
tcggaagccatagcaggtcttataactttggggtataaaatgcagcaggcaagagttgca
gtaaccaatgtttacgaacacaatgaaaatattactctggaagacttaataaaaaaatct
ctgcagtatttataa

DBGET integrated database retrieval system