KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_514Help
Entry
TGRD_514          CDS       T00755                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TGRD_514
Enzymes [BR:rsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TGRD_514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
748901..749806
Genome map
AA seq 301 aa AA seqDB search
MKIYLKAPAKINFFLEIKNKRADGYHNLESIMQTVSLYDELSFELTKNTISLECNDKSLY
AYKTNIVYKAAMAVKKHYNTDKGVKIYLKKEIPIGSGLGGGSSDAASTLKALAKLWNIKT
KKDELEQIATKLGADVPFFLTGGTALCEGIGEIVTPLKSAGKLNIVLVNPGFDVLTADIY
KKIKFPLTNQAKIHIIKNLIFNNSFNKKEAFKSCFNRLEEFIFPNYPEILEIKRVLNKLC
CASLMSGSGATVFGILDSDAKTEKLKSRLNRCGWKIWFVTTIDTSFHSLFPSTQSQSSGI
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatatctcaaagcgccggcaaaaatcaattttttccttgaaattaaaaataaa
agagccgatggataccataacttagaaagtattatgcaaaccgtaagtttatatgacgaa
ctttcttttgagcttactaaaaatacgatctctcttgaatgcaacgataaatctctatat
gcttacaagacaaatattgtttataaagcagcaatggcagttaaaaagcattacaatact
gataaaggcgtaaaaatatacttaaaaaaagaaattcctataggatccggtcttggcggc
ggttcttctgatgccgcttcaacacttaaagctttagccaaactgtggaatataaaaacg
aaaaaagatgaattagaacaaattgctacaaagctcggcgctgatgttcctttttttctg
acaggaggaacagcgctatgcgaaggaataggagaaattgtcacgcccttaaaaagcgcc
ggaaaattaaatatagttcttgtaaatccgggttttgacgttcttacagcagatatatat
aaaaaaatcaaattcccgttgacaaatcaagcaaaaattcatataataaagaatcttatt
ttcaataattcttttaataaaaaagaagcttttaaaagctgttttaacagacttgaagag
tttatttttcctaattatcctgaaatattagaaattaaaagagttttaaacaagctgtgt
tgcgcaagtcttatgtccggctccggcgcaacagtttttggtattttagattccgacgct
aaaaccgaaaaacttaaatccagactgaacagatgcggctggaaaatctggttcgttact
acaattgatacctcattccacagcctatttccctctacgcaatcacagagttccgggatt
gtgtaa

DBGET integrated database retrieval system