KEGG   Uncultured Termite group 1 bacterium phylotype Rs-D17: TGRD_595Help
Entry
TGRD_595          CDS       T00755                                 

Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
rsd  Uncultured Termite group 1 bacterium phylotype Rs-D17
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TGRD_595
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGRD_595
   00620 Pyruvate metabolism
    TGRD_595
   00650 Butanoate metabolism
    TGRD_595
  Lipid metabolism
   00071 Fatty acid degradation
    TGRD_595
  Amino acid metabolism
   00350 Tyrosine metabolism
    TGRD_595
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TGRD_595
   00626 Naphthalene degradation
    TGRD_595
Enzymes [BR:rsd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TGRD_595
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TGRD_595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(873033..875678)
Genome map
AA seq 881 aa AA seqDB search
MTGTKGKNVKLSERDVSAGYVIDSSEALNMLIQRVKKAQEVYSSFSQEQVDAIFKAVSIA
ANRSRIPLAKIAVEETGMGIVEDKVIKNHFACEYIYNKHKDAKTCGIISEDKPNGIKILA
EPVGVIAGIIPTTNPTSTVIFKSLISLKTRNAVIFSPHPKAKKSTVVAARIMLDAAVKAG
APSDIIGWIDVPSLELTNLLMTHKDIAIILATGGPGMVKAAYSSGKPALGVGAGNTPAVI
DETADIKMAVSSILISKTFDNGMICSSEQSIIIVKDVYDEVIKELKFRGAYILNEQEKEK
IAKTIILKGKLNPAIVGQSACKIADMSGVKVPSNAKVLVGEVSEISLEEEFAQEKLSPVI
AVYMAENFEDAVEKAYRLVELCGAGHTSVLYTDERKQNRINAFAGKLRTGRILINTPSSQ
GAIGDLYNFKLDPSLTLGCGSWGGNAVSENVGVKHLLNYKTVAERRENMLWFRIPPKIYF
KRGVTNSALRELQGKKRAFIVTDRFLFNSGVIYNITKVLEEINVDYQIFFDVKPDPTVST
VNEALLLIRNYEPDVIIAFGGGSPIDAAKIIWLMYEHPETDFKNIAMRFMDIRKRICKIP
ELGKKAQMIAIPTTSGTGSEVTPFAVITDDETHIKYPIADYVLTPNVAIIDPDFADSMPK
SLCAASGIDALTHAIEAYVSVLAANFTNSPALEAAKLIFKYLPSSYAAGKDDPVAKEKVH
YASTLAGMAFANAFLGLCHSVAHKLGAAFNLSHGIANALVINQVIRYNATERPGKQTVFP
QYKFPNAKAKYGQIADELNLGGGYHDDEKVDLLINAITQLKKDIQIPLSIKDTGVLEKDF
YDKLDELAEQAFDDQCTGANPVYPLIADIKNIFIKAYNGEV
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaacaaaggggaaaaatgttaaactttcggaaagagatgtcagcgcaggatac
gtgatcgacagttccgaagctctgaatatgcttattcagcgcgtaaaaaaagcgcaagaa
gtctactctagttttagtcaggaacaggttgacgcaatctttaaagcagtgtcgattgca
gctaatcgctctaggattcctcttgccaaaatagccgttgaagaaacagggatgggaatc
gtcgaagataaagttattaagaaccattttgcttgcgaatatatttataacaaacacaaa
gatgctaaaacttgcgggattatcagcgaagataaaccgaatggaattaaaattttagcc
gagcctgtcggcgttatcgctggtattattccgactacaaatcctacctccacagtaatt
tttaaatctctgatttctttaaagacaagaaacgctgtaattttttcgcctcatcccaaa
gctaaaaaatctactgtagtagctgccagaatcatgcttgatgcggcagttaaagctggt
gcgccatcggatataatcgggtggattgatgttccgtctctggaattgacaaatttgctt
atgacgcacaaagatatagctattattcttgctacaggcggaccgggaatggttaaagcc
gcttattcctcgggaaagccggctcttggcgtaggtgcgggcaatactcctgcggttata
gatgagacagctgatattaaaatggcggtttcttcaattcttatatcaaaaacttttgat
aacggcatgatttgctcatctgagcagtcaattataatagtaaaagatgtttatgatgaa
gttattaaggaattaaaatttcgtggcgcgtatattttgaacgaacaggaaaaagaaaaa
atagcaaaaacgataattctcaagggcaagttaaatcctgcgattgtcggtcagtctgcc
tgtaaaattgctgatatgtcgggagttaaagttccttcgaatgcgaaagttcttgtgggt
gaagtctctgaaatcagtttggaagaagaatttgcacaagaaaaattatcgccggtaatt
gcggtttacatggctgaaaactttgaagatgcagttgagaaggcttatcgtcttgtagag
ttgtgcggagcgggacatacatccgtgctttatactgatgaaagaaaacaaaatagaatt
aatgcgtttgctggcaagctgcgtaccggtcgtattttgattaacacgccgtcctcgcag
ggtgcaattggcgatttatacaactttaaactggatccgtcgttgacgctcggctgtggt
tcgtggggaggcaatgccgtgagcgaaaacgtaggcgtaaaacatttattaaactataaa
acagtcgctgagagacgtgaaaatatgttgtggtttagaatacctccgaagatttatttt
aaaagaggtgttacgaattctgcattacgtgaattgcagggtaaaaaacgagcgtttata
gttacagacagatttctctttaattccggcgtgatttataatattacaaaagtattggaa
gaaattaatgttgattatcagatattctttgacgtcaagccggatcctactgtttctaca
gtaaatgaagcgctgttgctgattaggaattatgaacctgatgtaattattgcttttggt
gggggttctcctattgatgcggcgaaaattatatggttgatgtatgagcatcccgaaact
gattttaaaaatattgcgatgcggtttatggatatcagaaaaagaatatgtaaaattcct
gaattgggtaagaaagcgcagatgattgcaattcccacaacttctggcaccgggtcggaa
gtaacgccgtttgccgtaattaccgatgatgaaactcatatcaaatatcctattgcagat
tatgtgctgactcctaatgtggcgattattgaccctgactttgccgattctatgccgaaa
agtttgtgtgcggcatctggtattgatgctttaactcatgccattgaagcttatgtgtct
gtgcttgctgcaaactttacaaattcacctgcgttagaagcggcaaaattgatattcaag
tatcttccgagttcttatgcggcggggaaggatgacccggttgcaaaagaaaaagttcat
tatgcgtcgactcttgcaggtatggcttttgcaaatgcatttctaggtttatgccactcg
gtggctcacaagcttggagcggcattcaatctgtctcacggaattgcgaatgctttagtt
atcaatcaggtaatccgctataatgcgacagaacgccccggaaagcagaccgtattcccg
cagtataaatttcctaatgctaaggcaaaatacggacaaattgcggatgagttaaatctt
ggcggcgggtatcatgatgacgaaaaagttgatttgttaattaacgcaataacgcagctt
aaaaaggatattcaaattccgctttcaataaaagatacaggtgtattggaaaaagatttt
tatgataagttggatgaacttgcggagcaggcgtttgacgatcagtgtaccggcgcaaat
cctgtttatccattgattgctgatattaaaaatatttttattaaggcttacaatggagaa
gtttaa

DBGET integrated database retrieval system