KEGG   Ralstonia solanacearum FQY_4: F504_1358Help
Entry
F504_1358         CDS       T02751                                 

Definition
Aspartate aminotransferase (EC:2.6.1.1)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:rse01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rse01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rse00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:rse00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1410407..1411648
Genome map
AA seq 413 aa AA seqDB search
MKTIQKSAKLNNVCYDIRGPVLEKAKQMEEEGHQIIKLNIGNLAPFGFDAPEEIQQDMIR
NLPNSAGYSDSKGIFAARKAVMHYTQQQGIKNVTLDDIYLGNGASELIALATNALLDAGD
ELLLPAPDYPLWTAMTSLSGGTPVHYLCDESNGWMPDLDDIRAKITPNTKGIVVINPNNP
TGALYSDALLHDIIAIAREHGLVIFADEVYDKVLFDDNRHTAMASLSEDVLTVTFNSLSK
SYRSCGYRAGWMVVSGDKRPAKDYIEGLNMLSSMRLCANVPGQWAIQTALGGYQSINDLV
APGGRMRRQRDLAYELITAIPGVSCVKPKAALYMFPRLDPSVYPIDDDQTFIRQLLEEER
VLLVQGTGFNWHSPDHFRIVFLPHEDDLREAIGRIARFLERYRQRHGTGIRAA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacgatccagaaatccgccaagctcaacaacgtctgctatgacatccgcggcccc
gtgctggagaaggccaagcagatggaggaagagggccaccagatcatcaagctgaacatc
ggcaacctggccccgttcggcttcgatgccccggaagagatccagcaggacatgatccgc
aacctgcccaactcggccggctactcggattccaagggcatcttcgcggcgcgcaaggcg
gtgatgcactatacgcagcagcagggcatcaagaacgtcacgctggacgacatctacctg
ggcaacggcgcctccgagctgatcgcgctggccaccaacgcgctgctcgacgccggcgac
gaactgctgctgcccgcacccgattacccgctgtggaccgccatgaccagcctgtcgggc
ggcacgccggtgcattacctgtgcgacgagtccaacggctggatgcccgacctggacgac
atccgcgccaagatcacgcccaacaccaagggcatcgtcgtcatcaacccgaacaatccg
accggcgcgctgtattcggacgcgctgctgcacgacatcatcgccatcgcacgcgagcac
gggctggtgatctttgccgacgaggtgtacgacaaggtgctgttcgacgacaatcggcac
accgcgatggcctcgctgtcggaggatgtgctgaccgtcacgttcaacagcctgtccaag
agctaccgctcgtgcggctaccgcgcgggctggatggtggtgtcgggcgacaagcgtccg
gccaaggactacatcgaaggcctgaacatgctgtcgtcgatgcgcctgtgcgccaatgtg
ccggggcagtgggcgatccagacggcgctgggcggctatcagagcatcaacgacctggtg
gcgccgggcggccgcatgcgccgccagcgcgacctggcctacgaactgatcaccgccatt
cccggcgtgagctgcgtcaagccgaaggcggcgctgtacatgttcccgcgcctggatccg
tcggtgtacccgatcgacgacgatcagaccttcattcgccaactgctggaggaagagcgc
gtgctgctggtgcagggcacgggcttcaactggcattcgccggaccacttccgcatcgtc
ttcctgccgcacgaggacgacctgcgcgaggccatcggccgaattgcacgcttcctggag
cggtaccgtcagcgtcacggtactggcatccgggccgcctga

DBGET integrated database retrieval system