KEGG   Ralstonia solanacearum FQY_4: F504_1628Help
Entry
F504_1628         CDS       T02751                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00071  Fatty acid degradation
rse00072  Synthesis and degradation of ketone bodies
rse00280  Valine, leucine and isoleucine degradation
rse00310  Lysine degradation
rse00362  Benzoate degradation
rse00380  Tryptophan metabolism
rse00620  Pyruvate metabolism
rse00630  Glyoxylate and dicarboxylate metabolism
rse00640  Propanoate metabolism
rse00650  Butanoate metabolism
rse00900  Terpenoid backbone biosynthesis
rse01100  Metabolic pathways
rse01110  Biosynthesis of secondary metabolites
rse01120  Microbial metabolism in diverse environments
rse01130  Biosynthesis of antibiotics
rse01200  Carbon metabolism
rse01212  Fatty acid metabolism
rse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rse00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    F504_1628
   00630 Glyoxylate and dicarboxylate metabolism
    F504_1628
   00640 Propanoate metabolism
    F504_1628
   00650 Butanoate metabolism
    F504_1628
  Lipid metabolism
   00071 Fatty acid degradation
    F504_1628
   00072 Synthesis and degradation of ketone bodies
    F504_1628
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F504_1628
   00310 Lysine degradation
    F504_1628
   00380 Tryptophan metabolism
    F504_1628
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F504_1628
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F504_1628
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    F504_1628
Enzymes [BR:rse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     F504_1628
Exosome [BR:rse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F504_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGH84142
UniProt: M4UG25
Position
complement(1757519..1758697)
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTGLAKSWKGAFNMTHGATMGGHVVKHAIERAKLEPGEVEDVLMGCANPE
GATGANIARQIALRAGCPVTVPGATVNRFCSSGLQTIAMAAQRVIADEGDIFVAGGVESI
SCVQQEMNRHMMTEGWLNRHKPEIYWSMLQTAETVAKRYNISKARQDEYGVQSQLRAAAA
AAAGKFNDEIVPITVTMGVADAKTGQLGTREVTLSADEGIRPDTTLEGVSKIRTAMPGGV
VTAGNASQFSDGASAAVVMNGKVAAARGLQPLGVFRGFAVAGCEPDEMGIGPVFAVPKLL
RKAGLKVEDIGLWELNEAFAVQVLYCADTLGIPMDRLNVNGGAIAVGHPYGVSGARLVGH
ALIEGKRRGVKYVVVTMCIGGGQGAAGLFEVL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcagtgatcgtttccaccgcacgtacgggcctggccaagagctggaagggc
gccttcaacatgacgcacggcgccaccatgggcggccacgtggtcaagcacgccatcgag
cgcgccaagctcgagccgggcgaagtcgaggacgtgctgatgggctgcgccaacccggaa
ggcgcgaccggcgccaatatcgcgcgccagatcgcgctgcgcgccggctgtcccgtcacc
gtgccgggcgcgaccgtcaaccgtttctgctcgtcgggcctgcagaccatcgccatggcc
gcgcagcgcgtgatcgccgatgaaggcgacatcttcgtggccggcggcgtggaatccatc
tcgtgcgtgcagcaggagatgaaccgccacatgatgaccgagggctggctcaaccggcac
aagcccgagatctactggagcatgctgcagacggccgagaccgtcgctaagcgctacaac
atttcgaaggcgcgccaggacgaatacggcgtgcagagccagctgcgcgccgccgccgct
gccgccgcgggcaagttcaacgacgagatcgtgccgatcacggtgacgatgggcgtggcc
gacgccaagaccggccagctcggcacgcgcgaggtgaccctctccgccgacgaaggcatc
cgcccggacaccacgctcgaaggcgtgtccaagatccgcacggccatgccgggcggcgtc
gtcaccgccggcaatgccagccagttctccgacggtgcctcggcggccgtggtgatgaac
ggcaaggtggcggccgcccgcggcctgcagccgctgggtgtgttccgcggtttcgcggtg
gccggctgcgagccggatgaaatggggatcggcccggtgttcgccgtgcccaagctgctc
aggaaggcgggcctgaaggtcgaggacatcggcctgtgggagctgaacgaggcgttcgcc
gtgcaggtgctgtattgcgccgacacgctcggcattccgatggatcgcctgaacgtcaac
ggcggcgccattgccgtgggccatccttacggcgtgtcgggcgcgcgcctggtcggccac
gccctgatcgaaggcaagcgccgcggcgtcaagtacgtggtcgtgaccatgtgcatcggc
ggcggccagggcgcggcgggcctgttcgaggtgctctga

DBGET integrated database retrieval system