KEGG   Ralstonia solanacearum FQY_4: F504_219Help
Entry
F504_219          CDS       T02751                                 

Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rse00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
231308..232831
Genome map
AA seq 507 aa AA seqDB search
MLAPPEVAALPDRLTFKPLGIDTWQEHVIYMHPDCAICRAEGFTAQARVEVRIGLRSLIA
TLNLVGSGLLEMCEVSLSVSAVETLMARPGDIVTVSHAPALESLRAVRAKIYGAHLDTHQ
LASVVGDIAKERYADVHIAAFLSACAGGRMSVKETIDLTQAMVDSGECLEWDREIVADKH
CVGGLPGNRTSPIVVAIAAAAGLLLPKTSSRAITSPAGTADTMETLTRVALSATELRRVV
DRVGASLAWGGALSLSPADDVLIRVERALDVDSDAQLAASILSKKIAAGSTHVLIDVPVG
PTAKVRSLQDLERLRMLLERVARSFGVRVTIVRTDGSQPVGRGIGPALEARDVLAVLQRS
PAAPFDLRERSLLLAATLLEFCGAVEQGAGLEMATGVLDSGAAWRKFEEICEAQGGLRVP
GEAIFRRDVVAEQDGIVTEIDNRHLARIAKLAGAPMRQVAGVEMHVRLHDQVKAGRPLFT
IHAQASGELEYSVAYALMHPAVSIAPT
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctccgcctgaggtggcagcactgcccgatcggcttaccttcaagccgttgggc
atcgacacttggcaggagcacgtcatctacatgcatccggattgcgcaatctgccgggct
gaggggttcactgcacaagctcgggtggaggtgcggatcggtctgcgctccttgattgcc
acactcaatctcgtcggctcaggcttgctggagatgtgtgaggtcagcttgtccgtcagc
gccgtcgagacgctgatggcgaggcccggcgatattgtgactgtcagtcacgcgcccgcg
ctggagtcgctgcgggcggtacgcgccaagatctatggggcgcatctggatacgcatcaa
ctggctagcgtcgtcggtgatattgccaaagagcggtatgccgacgtccacattgcggcg
ttcctgagcgcctgcgcaggcgggcgaatgagcgtcaaggagacaatcgatctcacccag
gccatggtcgactcgggcgaatgtctcgaatgggatcgcgagatcgtcgcggacaagcac
tgtgtgggcggcttgccgggcaaccgtaccagtcccatcgtggtcgccatcgctgccgct
gcaggcttgttgctacctaagacctcgtcgcgcgccatcacgtcacccgccggtaccgcc
gacacgatggagacactcacgcgtgttgctctgagcgccacggagttgcgacgcgtcgtt
gatcgggttggagcttcgctcgcgtggggcggtgcgctcagccttagccccgccgacgac
gtgctcattcgcgtggagcgggcgttggatgtggatagcgatgcccaacttgcggcctcc
attctgtcgaagaagatcgcggccgggtcaacccatgtcttgatcgacgtgcccgtgggg
ccgacggccaaggtgcgcagtctgcaggatttggagcgcctgcgtatgctgctcgagcgc
gtagcgcggtcgttcggcgtgcgcgtcacgatcgtgcgcacggacggctcgcagccggtt
ggcaggggaattggtccggcgcttgaagcacgagacgtcttggccgtgcttcaacgctct
cctgcggcgccgttcgacctgcgggagcggtcgttgttgctggctgcgactctgctagag
ttttgtggggcggtggagcagggggcagggcttgagatggccacaggcgtgctggacagt
ggtgcggcgtggcggaagttcgaggaaatctgcgaagcgcagggaggcctgcgtgtgcca
ggtgaggccatcttccgtcgtgatgtggtagctgagcaagacggcatcgtcaccgagatc
gacaaccgacatcttgctcgtatcgcgaaactcgcgggggctccgatgcgccaagtggca
ggcgtggagatgcacgtgagactacacgaccaggttaaggcggggcggcctctctttacc
atccatgcccaggcttcaggtgaactggaatattccgtagcttatgcactgatgcaccca
gcggtttccatcgccccgacttga

DBGET integrated database retrieval system