KEGG   Ralstonia solanacearum FQY_4: F504_2821Help
Entry
F504_2821         CDS       T02751                                 

Gene name
dsbC
Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rse  Ralstonia solanacearum FQY_4
Brite
Enzymes [BR:rse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     F504_2821 (dsbC)
Secretion system [BR:rse02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   F504_2821 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3020813..3021559)
Genome map
AA seq 248 aa AA seqDB search
MSFRIRVAAIASAALVVAMGAGYALTAGAAEPALDKVKASVQKALGSNVEIKGVAKSPLP
GLYEVNLGSQVVYTDATGRYVLNGDLLDTQTATNLTQERMAEINRIKWSDLPLDRAVKWV
KGNGARKVAVFSDPNCPYCHKLEQMFSQVDNITVYTFLFPILSEDSNTKAKQIWCASDRA
KAWRDWMVSKSAPGGAGNCDTPLEDNLKLGRALNVNGTPAIIFMDGSRAPGLIDAATLER
KFASLKKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcgtattcgggtggcggccatcgcctcggcggcgctggttgtcgccatgggc
gcgggctacgcgctgaccgccggtgccgccgagcccgcgctggacaaggtcaaggcctcg
gtgcagaaggcgctgggatcgaacgtcgagatcaagggcgtggccaagtcgccgctgccg
gggctgtacgaggtgaatctcggcagccaggtcgtctacacggatgccaccggccgctat
gtgctcaacggcgacctgctcgatacgcagactgcgaccaacctcacgcaggagcgcatg
gccgagatcaaccgcatcaagtggtccgacctgccgctggatcgcgcggtgaagtgggtc
aagggcaacggcgcgcgcaaggttgccgtgttctccgatccgaactgcccgtactgccac
aagctggagcagatgttctcgcaggtcgacaacatcacggtctacaccttcctgttcccg
atcctgtccgaggactccaacaccaaggccaagcagatctggtgcgcgtctgaccgtgcc
aaggcctggcgcgactggatggtgtccaagagcgctccgggcggtgccggcaattgcgac
acgccgctggaagacaacctcaagctgggccgcgcgctcaacgtcaacggcaccccggcc
atcatcttcatggacggctcgcgggcgccgggcctgatcgatgcggccacgctggaacgc
aagttcgcgtcgctgaagaagtcgtga

DBGET integrated database retrieval system