KEGG   Ralstonia solanacearum FQY_4: F504_3606Help
Entry
F504_3606         CDS       T02751                                 

Definition
degradation of polysaccharides
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F504_3606
Enzymes [BR:rse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     F504_3606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:143419..144789
Genome map
AA seq 456 aa AA seqDB search
MKVIHLSFPSLSISPFFHFVMKSRFRIAAANRMHRCMPLVAASMAALMLAGCGGGDGDTA
LSTAAATDTTTLKTAATTSISPLWLTVAKDSAAFTVSGTRTVRYGAGSAWVAKSMSGTGQ
CTAAFFGKDPAAGVAKVCQVAQGTGTLLWRGVSLAGAEFGEGSLPGTYGSNYIYPSADSA
TYYKNKGMNLVRLPFRWERLQPTLNQALDANELSRLTGFVNAVTAAGQTVLLDPHNYARY
YGNVIGSSAVPNSAYADFWRRVATQFKGNARVIFGLMNEPNSMPTEQWLSGANAALAAIR
SANASNVVFVPGNAWTGAHSWNQNWYGTPNGTVMKGINDPGRNLVFEVHQYLDGDSSGQS
ASCVSATIGAERLQDFTNWLRSNGYRGFLGEFGAASNDTCNQAVGNMLTFMKNNADVWTG
WAWWAGGPWWGGYMYSIEPSNGVDKPQMSVLAPYLK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtcattcacctgtcatttccatccctatcgatttctccatttttccatttcgtc
atgaaatccagattccgaattgcagccgcaaatcgcatgcaccgatgcatgccgctggtt
gccgcttcgatggcggccctcatgctagccggttgcggtggcggcgacggtgacaccgcc
ctcagcacggcggccgctaccgacaccacgaccctgaagacggccgccaccacctcgatc
tcgccgttgtggctcaccgtcgccaaggacagcgcggcgttcacggtgagcggcacgcgc
acggtgcgctatggcgccggcagcgcgtgggtggcgaagagcatgtccggcacaggccag
tgcaccgccgccttcttcggcaaggatccggcggccggtgtcgccaaggtgtgccaagtg
gcgcagggcacgggcaccctgctgtggcgcggcgtcagcctggccggcgccgagttcggg
gagggcagcctgccgggcacctacgggagcaactacatctatccgtccgccgacagcgcg
acctactacaagaacaagggcatgaacctggtgcgcctgccgttccgctgggagcggctg
cagcccacgctcaaccaggcgctcgacgcgaacgagctgtcgcgcctgaccgggttcgtc
aacgccgtgacggcggccggccagacggtgctgctcgatccgcacaactacgcgcgctac
tacggcaacgtgatcggctcgagcgcggtgcccaacagcgcgtacgccgatttctggcgg
cgcgtggccacccagttcaagggcaatgcccgcgtcatcttcgggctgatgaacgagccc
aattcgatgccgaccgagcagtggctgtccggcgccaacgccgcgctggccgcgatccgc
tcggccaatgcgagcaacgtggtgttcgtgcccggcaacgcctggacgggcgcgcacagc
tggaaccagaactggtacggcacgccgaacggcaccgtcatgaagggcatcaatgacccg
ggccgcaacctcgtcttcgaggtgcaccagtacctggacggcgattcgtccggccagtcg
gccagctgcgtgagcgccaccatcggcgccgagcggctgcaggacttcaccaactggctg
cgcagcaacggctatcgcggcttcctgggcgagttcggcgcggcctccaatgacacttgc
aaccaggctgtcggcaacatgctcaccttcatgaagaacaatgccgatgtctggaccggc
tgggcgtggtgggcgggcggtccgtggtggggcggctacatgtactcgatcgagccgtcg
aacggcgtggacaagccgcagatgtcggtgctggcgccgtacctgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system