KEGG   Ralstonia solanacearum FQY_4: F504_3679Help
Entry
F504_3679         CDS       T02751                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F504_3679
Enzymes [BR:rse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     F504_3679
Exosome [BR:rse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F504_3679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(250446..252773)
Genome map
AA seq 775 aa AA seqDB search
MTSVHDFATATRPATPSAAAQEPAPALPPGLDRNTLDALTHGRLGDPFAVLGPHRLETAE
GERPHRVMRAFHPGARRVQAIDPRGQVMAELAPVGRTGLFHGRLPDDAPDADGRPGAYRL
RVIWPAGAGHEAVQEAEDPYAFGLLLGDLDLHLIAEGRHWELARCLGAQAMRQDDVAGVR
FAVWAPNARRVSVVGDFNQWDGRRHPMRLRHGTGVWELFVPAGLGAGPGSRYKFELVGAD
GHLLVKADPVARRTEAPPATASVVADPLPFRWSDAAWMETRAARQRPDAPIAIYEVHAGS
WLRDVEDGGRSLDWDALGERLIPYVAGLGFTHVELLPVAEHPFGGSWGYQPLGLFAPSAR
FGPPEAFARFVERCHQAALGVIVDWVPAHFPSDPHGLARFDGTALYEHADPREGFHQDWN
TLIYNFGRHEVRGFLIASALEWLEHFHIDGLRVDAVASMLYRDYSRPADAWVPNRYGGRE
NLEAVAFLQQMNAVVHARCPGAITIAEESTAWPGVTAAVEFNGLGFDYKWNMGWMHDTLH
YMQRDPIYRQHHHDGLTFGLVYAFSERFILPLSHDEVVHGKGSLLGKMPGDDWQRLANLR
AYLAFMWTHPGKKLLFMGGEFGQLGEWNHDAAPEWHLLDDPRHRGVQRLVHDLNALYRSE
PALHARDCAPEGFSWVIGDDRANSVFAYLRLDTAGTPMLIVANMTPVPRDGYRIGVPDVD
GAVRWREMLNTDSAVYGGTNLGNGGVVDVEDVESHGWRRSVVVRLPPLAVVVLKV
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcggtccatgacttcgccacggccacccggccggccacgcccagcgcggcggcc
caggagcctgcgcccgcgctgccgcccggcctcgaccggaacacgctggacgcgctgacg
cacggtcggctgggcgacccgttcgcggtgctggggccgcatcggctggagacggccgag
ggggagaggccgcaccgggtgatgcgcgccttccatcccggcgcgcggcgcgtgcaggcc
atcgacccgcgcggccaggtcatggccgaactggcgccggtcgggcgcactgggctgttc
cacggacggctgcccgacgacgcgcccgatgccgacggccgccccggcgcctaccggctg
cgcgtgatctggccggccggcgccggccatgaagcggtgcaggaagcggaagacccctac
gccttcggcctgctgctgggcgacctggacctgcacctgatcgccgaaggccggcactgg
gaactggcccgctgcctgggtgcccaggccatgcggcaggacgatgtggccggcgtgcgc
tttgccgtgtgggcacccaatgcccggcgcgtgtcggtggtcggcgacttcaaccagtgg
gacggccgccgccacccgatgcggctgcgccacggcaccggcgtgtgggagctgttcgtg
cccgccggcctgggcgcgggcccgggctcgcgctacaagttcgagctggtgggcgccgac
gggcatctgctggtcaaggccgacccggtggcacgccgcaccgaagcgccgcccgcgacc
gcctcggtggtggccgatccgctgccgttccgatggtccgacgcggcgtggatggaaacc
cgcgccgcgcgccagcggcccgatgcgccgatcgccatctacgaggtgcacgcgggctcg
tggctgcgcgacgtggaagacggcggccgcagcctggactgggacgcgctgggcgagcgg
ctgattccgtacgtggccgggctcggcttcacgcatgtcgaactgctgccggtggccgag
catccgttcggcggcagttggggctaccagccgctggggctgttcgcgccgtcggcgcgc
ttcggcccgccggaggccttcgcgcgctttgtcgagcgctgccaccaggcggcgctgggc
gtcatcgtcgactgggtgccggcgcactttccctccgacccacacggcctggcgcgcttc
gacggcaccgcgctctacgagcacgccgacccacgcgaaggcttccaccaggactggaac
accctcatctacaacttcggccgccacgaggtgcgcggcttcctgatcgccagcgcgctg
gaatggctcgagcacttccacatcgacggcctgcgcgtcgacgcggtggcctcgatgctc
tatcgcgactactcccgcccggccgacgcctgggtgcccaaccgctacggcggccgcgag
aacctggaggcggtcgccttcctgcagcagatgaacgccgtggtgcacgcgcgctgcccc
ggcgccatcaccatcgccgaagagtccaccgcgtggccgggcgtcaccgccgccgtcgaa
ttcaacggactgggcttcgactacaagtggaacatgggctggatgcacgacacgctgcac
tacatgcagcgcgaccccatctaccgccagcaccatcatgacggcctgaccttcggcctg
gtctacgccttctccgaacggttcatcctgccgctgtcgcacgacgaagtcgtgcacggc
aagggctcgctgctgggcaagatgcccggcgacgactggcagcgcctggccaacctgcgc
gcctacctggccttcatgtggacgcatcccggcaagaagctgctgttcatgggcggcgag
ttcggccagctcggcgagtggaaccacgatgccgcgccggaatggcacctgctggacgac
ccgcggcaccgcggcgtgcagcggctggtgcacgacctgaacgccctctaccgcagcgaa
ccggccctgcacgcgcgcgactgcgcgcccgaaggcttcagctgggtgatcggcgacgac
cgcgccaacagcgtctttgcctacctgcggctcgacaccgcaggcacgccgatgctgatc
gtggccaacatgaccccggtgccgcgcgacggctaccggatcggcgtgccggatgtcgat
ggcgcggtgcggtggcgcgaaatgctcaataccgacagtgcggtgtatggcgggaccaat
cttgggaatggcggtgttgtggatgtagaggatgtggagtcgcacgggtggcggcggtcg
gtggtggtgcggttgccgccgttggctgttgtggtgttgaaggtttga

DBGET integrated database retrieval system