KEGG   Ralstonia solanacearum FQY_4: F504_4323Help
Entry
F504_4323         CDS       T02751                                 

Definition
Acetaldehyde dehydrogenase, acetylating (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rse00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    F504_4323
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    F504_4323
   00650 Butanoate metabolism
    F504_4323
  Amino acid metabolism
   00360 Phenylalanine metabolism
    F504_4323
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F504_4323
   00622 Xylene degradation
    F504_4323
   00621 Dioxin degradation
    F504_4323
Enzymes [BR:rse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     F504_4323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(1079025..1079945)
Genome map
AA seq 306 aa AA seqDB search
MTRKLKVAIIGSGNIGTDLMIKVLRHGGPIEMGAMVGIDPGSDGLARAARLGVPTTAEGL
EGLLRLPGFKDIGLVFDATSAGAHHRHAARLAELGVPMIDLTPAAIGPYVVPVVNGEAHR
GARNINMVTCGGQATIPIVAAVSQVARVHYAEIVASIASRSAGPGTRANIDEFTETTSRA
IEAVGGAERGKAIIILNPAEPPLMMRDTVFTFSAPASESEVEASIEAMVAKVQAYVSGYR
LKQRVQFEHTEVALPGAGRVRGLKTTVLLEVRGAAHYLPEYAGNLDIMTSAALACAQAQA
AALIAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgaaagcttaaggttgcaatcatcggatcgggcaacatcggcaccgatctcatg
atcaaggtgctgcgccacggcgggcccatcgaaatgggcgcgatggtagggatcgatccc
ggctccgacgggctggcgcgcgccgcgcggctgggcgtgcccaccacggccgaaggcctg
gagggcctgctgcgcctgccgggcttcaaggacatcggcctggtcttcgatgccacatcg
gcgggggcgcatcaccggcacgcggcccggctggccgagctcggcgtgccgatgatcgat
ctcacgcccgcggccatcggcccgtacgtggtgccggtggtcaatggcgaagcgcaccgg
ggcgcccggaacatcaacatggtgacctgcggcggacaggcgacgatccccatcgtggcg
gccgtatcgcaggttgcccgcgtgcactacgctgagatcgtcgcgtcgatcgccagccgg
tccgccggccccggcacgcgcgccaacatcgacgagttcaccgagaccacgtcgcgggcg
atcgaggcggtcgggggcgccgagcgcggcaaggccatcatcatcctcaatccggccgag
ccgccgctgatgatgcgcgacaccgtgttcaccttcagcgcccccgcgagcgaaagcgag
gtggaggccagcatcgaagcgatggtcgccaaggtgcaggcctacgtgtccggctaccgg
ctcaagcagcgggtgcagttcgagcacaccgaggtcgcgctgcccggcgccggccgcgtg
cgcgggctcaagaccaccgtcctgctggaggttcgcggggcggcacactacctgccggaa
tacgccggcaacctcgacatcatgacgtcggcggccctggcgtgtgcgcaagcgcaggcg
gcggccctcattgccgcgtga

DBGET integrated database retrieval system