KEGG   Ralstonia solanacearum FQY_4: F504_4323Help
Entry
F504_4323         CDS       T02751                                 

Definition
(GenBank) Acetaldehyde dehydrogenase, acetylating
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00360  Phenylalanine metabolism
rse00362  Benzoate degradation
rse00620  Pyruvate metabolism
rse00621  Dioxin degradation
rse00622  Xylene degradation
rse00650  Butanoate metabolism
rse01100  Metabolic pathways
rse01120  Microbial metabolism in diverse environments
rse01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rse00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    F504_4323
   00650 Butanoate metabolism
    F504_4323
  Amino acid metabolism
   00360 Phenylalanine metabolism
    F504_4323
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F504_4323
   00622 Xylene degradation
    F504_4323
   00621 Dioxin degradation
    F504_4323
Enzymes [BR:rse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     F504_4323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AGH86833
UniProt: M4UKE6
Position
megaplasmid:complement(1079025..1079945)
Genome map
AA seq 306 aa AA seqDB search
MTRKLKVAIIGSGNIGTDLMIKVLRHGGPIEMGAMVGIDPGSDGLARAARLGVPTTAEGL
EGLLRLPGFKDIGLVFDATSAGAHHRHAARLAELGVPMIDLTPAAIGPYVVPVVNGEAHR
GARNINMVTCGGQATIPIVAAVSQVARVHYAEIVASIASRSAGPGTRANIDEFTETTSRA
IEAVGGAERGKAIIILNPAEPPLMMRDTVFTFSAPASESEVEASIEAMVAKVQAYVSGYR
LKQRVQFEHTEVALPGAGRVRGLKTTVLLEVRGAAHYLPEYAGNLDIMTSAALACAQAQA
AALIAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgaaagcttaaggttgcaatcatcggatcgggcaacatcggcaccgatctcatg
atcaaggtgctgcgccacggcgggcccatcgaaatgggcgcgatggtagggatcgatccc
ggctccgacgggctggcgcgcgccgcgcggctgggcgtgcccaccacggccgaaggcctg
gagggcctgctgcgcctgccgggcttcaaggacatcggcctggtcttcgatgccacatcg
gcgggggcgcatcaccggcacgcggcccggctggccgagctcggcgtgccgatgatcgat
ctcacgcccgcggccatcggcccgtacgtggtgccggtggtcaatggcgaagcgcaccgg
ggcgcccggaacatcaacatggtgacctgcggcggacaggcgacgatccccatcgtggcg
gccgtatcgcaggttgcccgcgtgcactacgctgagatcgtcgcgtcgatcgccagccgg
tccgccggccccggcacgcgcgccaacatcgacgagttcaccgagaccacgtcgcgggcg
atcgaggcggtcgggggcgccgagcgcggcaaggccatcatcatcctcaatccggccgag
ccgccgctgatgatgcgcgacaccgtgttcaccttcagcgcccccgcgagcgaaagcgag
gtggaggccagcatcgaagcgatggtcgccaaggtgcaggcctacgtgtccggctaccgg
ctcaagcagcgggtgcagttcgagcacaccgaggtcgcgctgcccggcgccggccgcgtg
cgcgggctcaagaccaccgtcctgctggaggttcgcggggcggcacactacctgccggaa
tacgccggcaacctcgacatcatgacgtcggcggccctggcgtgtgcgcaagcgcaggcg
gcggccctcattgccgcgtga

DBGET integrated database retrieval system