KEGG   Ralstonia solanacearum FQY_4: F504_4430Help
Entry
F504_4430         CDS       T02751                                 

Definition
Fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rse01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rse01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(1212493..1213398)
Genome map
AA seq 301 aa AA seqDB search
MIEESVMLRQHNLRLRKYDYVLGRLFVALPIGGLVVAVLLLFADWRVGRFELAMCLAMYL
FTMMGIEVGFHRCFAHRAFKAGTGLQWVLAVAGSMGGHGPLIWWVTTHRRHHRFVDTDQD
PHTPNKDLRGPWRNFKSFLYGYVGWTMDTDVKLQEGWQRYGVDLYKNSILFKVHARFALI
ALLGLLLPTVAGALFHRTAEGALLGLLWGGLVPICLTQHLFWMINAFGHRIGAKPFNGRI
VGDSRNCWWLALPTFGQGWHNNHHADPGCATTRKTWWQLDPGAWLIRLFERLGWASAVKW
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagagtccgtcatgctgcggcagcacaacctgcggctgcgcaagtacgactat
gtcctggggcgcctgttcgtggccttgccgatcggcgggctggtggtcgccgtgctgctg
ttgtttgcggattggcgggtgggccggttcgagctggcgatgtgcctggcgatgtatctg
ttcacgatgatggggatcgaggtcgggttccatcgctgcttcgcgcaccgcgccttcaag
gccggcacgggcttgcaatgggtgctcgcggtggccggctccatgggcgggcatggccct
ctgatctggtgggtcaccacccatcggcggcatcaccggtttgtcgataccgaccaggat
ccgcatacgcccaacaaggatctgcgcggcccgtggcgcaacttcaagtcgttcctctac
ggctacgtcggctggaccatggatacggacgtgaagctgcaggaaggctggcagcgctat
ggcgtcgatctctacaagaacagcatcctgttcaaggtgcacgcgcgcttcgccctgatc
gcgctgctggggctgctgctgcccaccgtggccggggcgctgttccatcgcacggccgag
ggcgcgctgctggggctgctgtggggcggcctggtgccgatctgcctgacgcagcatctg
ttctggatgatcaatgcgttcgggcaccggatcggcgccaagcccttcaacggccggatc
gtcggcgacagccgcaattgctggtggctggcgctgccgaccttcggccagggctggcac
aacaaccaccacgccgatcccggatgcgccaccacgcgcaagacctggtggcagctggac
cccggcgcctggctgatccgcctgttcgagcggctgggctgggccagcgccgtcaagtgg
aaatag

DBGET integrated database retrieval system