KEGG   Ralstonia solanacearum FQY_4: F504_508Help
Entry
F504_508          CDS       T02751                                 

Definition
NAD-specific glutamate dehydrogenase (EC:1.4.1.2)
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:rse00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rse00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rse00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:rse00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
522203..523504
Genome map
AA seq 433 aa AA seqDB search
MSNVASPSTLQHAIPSYLPADNLGPWGIYLQQVDRVTPYLGSLARWVETLKRPKRALIVD
VPIQMDDGRIAHFEGYRVQHNTSRGPGKGGVRFHQDVTLSEVMALSAWMSVKNAAVNVPY
GGAKGGVRVDPRKLSSGELERLTRRYTSEIGIIIGPNKDIPAPDVNTNAQIMAWMMDTYS
MNEGATATGVVTGKPIALGGSLGRREATGRGVFVVGSEAARNLGIDVKGARIVVQGFGNV
GSVAAKLFQDAGAKVIAVQDHKGIVFNGAGLDVDALIQHVDHNGSVDGFKAETLSADDFW
ALECEFLIPAALEGQITGKNAPQIKAKIVVEGANGPTTPEADDILRDRGILVCPDVIANA
GGVTVSYFEWVQDFSSFFWTEDEINQRLVRIMQDAFRAIWQVAQDNKVTLRTAAFIIACT
RILQARQERGLYP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatgtcgcatctccgtcgacgctccagcacgccattccgtcctacctgccagcc
gataacctcggtccgtggggcatctacctgcagcaggtcgatcgggtcaccccctatctc
ggctcgctggcacgctgggtcgaaaccctgaagcgtcccaagcgcgccctgatcgtcgac
gtgcccatccagatggatgacggccgcatcgcccacttcgagggctaccgcgtgcagcac
aacacgtcgcgcggcccgggcaagggcggggtgcgtttccaccaggacgtgacgctgtcg
gaagtgatggcgctgtcggcctggatgtcggtcaagaacgcggccgtcaacgtgccgtac
ggcggcgccaagggcggcgtccgcgtcgatccgcgcaagctgtcgtcgggcgagctcgag
cgcctgacccgccgctacaccagcgagatcggcatcatcatcggcccgaacaaggacatc
ccggcgccggacgtgaacaccaacgcgcagatcatggcgtggatgatggacacgtactcc
atgaacgaaggcgccaccgccaccggcgtggtgaccggcaagccgatcgcgttgggcggc
agcctgggccgccgcgaggcgaccggccgcggcgtgttcgtggtcggcagcgaggctgca
cgcaatctgggcatcgacgtcaagggtgcgcgcatcgtggtgcaaggcttcggcaacgtc
ggcagcgtggccgccaagctgttccaggatgccggcgccaaggtgatcgcggtgcaggac
cacaagggcatcgtgttcaacggcgcgggcctggacgtcgacgcgctgatccagcacgtg
gaccacaacggcagcgtcgacggcttcaaggccgagaccctgtcggcggacgatttctgg
gcgctggaatgcgaattcctgatcccggccgcgctcgaaggccagatcaccggcaagaac
gcgccccaaatcaaggcaaaaattgtcgttgaaggtgcaaacggccccacgacgcccgaa
gcggacgacatcctgcgcgatcgcggcatcctggtctgcccggacgtgatcgccaatgcc
ggcggcgtcacggtgagctatttcgagtgggtgcaggatttctcgagcttcttctggacc
gaagacgagatcaaccagcgcctggtacggatcatgcaagatgctttccgcgccatctgg
caggtggcccaggacaacaaggtaactctgcggacggcggcgttcatcatcgcctgtacg
cggattctgcaggcgcgccaagagcgcggtctgtacccctga

DBGET integrated database retrieval system