KEGG   Ralstonia solanacearum FQY_4: F504_508Help
Entry
F504_508          CDS       T02751                                 

Definition
NAD-specific glutamate dehydrogenase (EC:1.4.1.2)
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rse00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    F504_508
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F504_508
   00330 Arginine and proline metabolism
    F504_508
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    F504_508
Enzymes [BR:rse01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     F504_508
Exosome [BR:rse04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   F504_508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
522203..523504
Genome map
AA seq 433 aa AA seqDB search
MSNVASPSTLQHAIPSYLPADNLGPWGIYLQQVDRVTPYLGSLARWVETLKRPKRALIVD
VPIQMDDGRIAHFEGYRVQHNTSRGPGKGGVRFHQDVTLSEVMALSAWMSVKNAAVNVPY
GGAKGGVRVDPRKLSSGELERLTRRYTSEIGIIIGPNKDIPAPDVNTNAQIMAWMMDTYS
MNEGATATGVVTGKPIALGGSLGRREATGRGVFVVGSEAARNLGIDVKGARIVVQGFGNV
GSVAAKLFQDAGAKVIAVQDHKGIVFNGAGLDVDALIQHVDHNGSVDGFKAETLSADDFW
ALECEFLIPAALEGQITGKNAPQIKAKIVVEGANGPTTPEADDILRDRGILVCPDVIANA
GGVTVSYFEWVQDFSSFFWTEDEINQRLVRIMQDAFRAIWQVAQDNKVTLRTAAFIIACT
RILQARQERGLYP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatgtcgcatctccgtcgacgctccagcacgccattccgtcctacctgccagcc
gataacctcggtccgtggggcatctacctgcagcaggtcgatcgggtcaccccctatctc
ggctcgctggcacgctgggtcgaaaccctgaagcgtcccaagcgcgccctgatcgtcgac
gtgcccatccagatggatgacggccgcatcgcccacttcgagggctaccgcgtgcagcac
aacacgtcgcgcggcccgggcaagggcggggtgcgtttccaccaggacgtgacgctgtcg
gaagtgatggcgctgtcggcctggatgtcggtcaagaacgcggccgtcaacgtgccgtac
ggcggcgccaagggcggcgtccgcgtcgatccgcgcaagctgtcgtcgggcgagctcgag
cgcctgacccgccgctacaccagcgagatcggcatcatcatcggcccgaacaaggacatc
ccggcgccggacgtgaacaccaacgcgcagatcatggcgtggatgatggacacgtactcc
atgaacgaaggcgccaccgccaccggcgtggtgaccggcaagccgatcgcgttgggcggc
agcctgggccgccgcgaggcgaccggccgcggcgtgttcgtggtcggcagcgaggctgca
cgcaatctgggcatcgacgtcaagggtgcgcgcatcgtggtgcaaggcttcggcaacgtc
ggcagcgtggccgccaagctgttccaggatgccggcgccaaggtgatcgcggtgcaggac
cacaagggcatcgtgttcaacggcgcgggcctggacgtcgacgcgctgatccagcacgtg
gaccacaacggcagcgtcgacggcttcaaggccgagaccctgtcggcggacgatttctgg
gcgctggaatgcgaattcctgatcccggccgcgctcgaaggccagatcaccggcaagaac
gcgccccaaatcaaggcaaaaattgtcgttgaaggtgcaaacggccccacgacgcccgaa
gcggacgacatcctgcgcgatcgcggcatcctggtctgcccggacgtgatcgccaatgcc
ggcggcgtcacggtgagctatttcgagtgggtgcaggatttctcgagcttcttctggacc
gaagacgagatcaaccagcgcctggtacggatcatgcaagatgctttccgcgccatctgg
caggtggcccaggacaacaaggtaactctgcggacggcggcgttcatcatcgcctgtacg
cggattctgcaggcgcgccaagagcgcggtctgtacccctga

DBGET integrated database retrieval system