KEGG   Ralstonia solanacearum FQY_4: F504_779Help
Entry
F504_779          CDS       T02751                                 

Definition
Kynureninase (EC:3.7.1.3)
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rse00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    F504_779
Enzymes [BR:rse01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     F504_779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(783345..784598)
Genome map
AA seq 417 aa AA seqDB search
MPLTRNTCLERDAADPIAPLRDAFALPDGVIYLDGNSLGARPHAALARAQQVIADEWGEG
LIRSWNQAGWFELPRRLGNKLAPLIGARADEVVITDTTSINLFKVLAAALRVQREDAPER
RIIVSEAHNFPTDLYIAEGLADLLRDGYKLRLIDAPDALETALGDDVAVTMLTHVNYKSG
HMYDMAAVSALAHRHGALAVWDLAHSAGAVPVDLHAGGADYAIGCTYKYLNGGPGSPAFV
WASPALRERFWQPLSGWWGHARPFAMASHYDAGAGIGRFLCGTQPITSMAMVECGLDIFA
QTSMTVLRAKSLALTDLFIELVEARCAGYPLTLATPRDHAVRGSHVSYAHPDGFAVMQAL
IARGVIGDYREPSIMRFGFTPLYTRFVDVWDAVDVLREVLETGAWQSAQFNERTLVT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcacccgcaacacctgcctcgaacgcgacgcggccgacccgatcgctccgctg
cgcgatgccttcgccctgcccgacggcgtgatctacctggacggcaactcgctcggcgcc
cgtccccatgccgcgctcgcccgtgcccaacaggtcatcgccgacgaatggggcgagggc
ctgatccgcagctggaaccaggccggctggttcgagctgccgcgacgcctgggcaacaag
ctcgccccgctgatcggcgcgcgcgcggacgaggtggtcatcaccgacaccacctcgatc
aacctgttcaaggtgctggccgccgccctgcgcgtgcagcgcgaggatgcgccggaacgc
aggatcatcgtctcggaagcgcacaacttcccgaccgacctctacatcgccgagggcctg
gccgacctgctgcgcgacggctacaagctgcgcctgatcgatgcgccggacgcgctggaa
accgcgctgggcgacgacgtggccgtcaccatgctcacgcacgtcaactacaagagcggc
cacatgtacgacatggcagccgtctcggcattggcgcacaggcacggcgcgctggccgtc
tgggacctcgcgcactcggccggcgccgtgcccgtggaccttcacgccggcggcgccgac
tacgccatcggctgcacctacaaatacctgaacggcggcccgggctcgccggccttcgtg
tgggcctcgcccgcgctgcgcgagcgcttctggcagccgctgtcgggctggtggggccac
gcgcggccgttcgcgatggcgtcacactacgatgccggcgccggcatcgggcgcttcctg
tgcggcacccagccgatcacatcgatggcgatggtcgaatgcgggctggacatcttcgcc
cagacctcgatgaccgtgctgcgcgccaagtcgctcgcgctgaccgatctcttcatcgaa
ctggtcgaggcccgctgcgccggctacccgctgacgctcgccaccccgcgcgaccacgcg
gtgcgcggcagccacgtcagctatgcgcacccggacggctttgccgtgatgcaggcgctg
atcgcgcgcggcgtgatcggcgactaccgcgaaccgagcatcatgcgcttcggcttcacg
ccgctgtacacgcgcttcgtcgacgtgtgggatgcggtcgacgtgctgcgcgaggtgctg
gaaaccggcgcgtggcaatccgcccaattcaacgaacgtacgctggtgacctga

DBGET integrated database retrieval system