KEGG   Ralstonia solanacearum FQY_4: F504_978Help
Entry
F504_978          CDS       T02751                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rse00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    F504_978
Enzymes [BR:rse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     F504_978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1009215..1010162)
Genome map
AA seq 315 aa AA seqDB search
MVAKRSALSSAAADVLVVGSLNMDLVIRTPCLPRPGQTVAAPALETIPGGKGANQAVASA
RLGSRVAMLGCVGDDPHGMALREGLLREGVDTAMVTAHAGAPTGIACVTVADNGQNTIVI
VAGANRQLTPAMIDAQRAAFERAKVIVCQLESPPDAVERALLLGQRLGKTVILNPAPAAG
PLPTPWLAACDYLIPNETEAALLTARRVDSPEAALNAAADLHAQGARHVIVTLGARGVAY
VDATTRLLMPAHPAQAIDTTAAGDTFVGALATALAEGAAPVEAIQFGLAAAAVSVTRLGA
QPSIPFRSELASPVQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaagcgttccgctctctcctcggccgctgccgacgtgctggtcgtcggcagc
ctcaacatggatctcgtgatccgcaccccttgtttgccccgtccggggcaaacggttgcc
gcgccggcgctggaaaccatccccggcggcaagggcgccaaccaggccgtggcctcggcg
cgcctgggcagccgcgtcgccatgctcggctgcgtgggcgacgacccccacggcatggcc
ctgcgcgaaggcctgctgcgggaaggcgtcgataccgcgatggtgaccgcgcatgcgggc
gcgcccacgggcatcgcctgcgtgacggtggccgacaacggtcagaacaccatcgtgatc
gtggccggcgccaaccggcagctgaccccggcgatgatcgacgcacagcgggccgccttc
gagcgggccaaggtcatcgtctgccagttggaatcgccgccggacgcggtggagcgcgcg
ctgctgctcgggcagcggctgggcaagaccgtcatcctgaacccggcgcccgccgccggt
ccgctgccgacgccgtggctcgccgcctgcgactacctgatccccaacgagaccgaagcc
gcgctgctgacggcgcggcgggtggattcgcccgaagcggcactgaacgccgccgccgat
ctgcatgcgcagggcgcgcgccacgtcatcgtcacgctgggcgcgcgcggcgtcgcctac
gtggatgcgaccacccgcctgctgatgcccgcccatcccgcgcaggccatcgacaccacc
gcggccggcgataccttcgtcggcgcgctggccacggcgctggcggagggcgcggcgccg
gtcgaggcgatccagttcggcctggccgcggccgcggtgtcggtcacgcggctgggtgcg
cagccctcgattccgttccgcagcgaactggcctcaccggtgcaatag

DBGET integrated database retrieval system